(data stored in ACNUC7421 zone)

EMBL: CP000821.PE77

CP000821.PE77        Location/Qualifiers
FT   CDS_pept        complement(85129..86841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0077"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="KEGG: sbl:Sbal_3979 flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34690"
FT                   /db_xref="GOA:A8FPB7"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB7"
FT                   /protein_id="ABV34690.1"
FT                   /translation="MSTTLAQPSPNMTDVRDKSEIVSSLKTKWQQFNRGDRQVLVLAIL
FT                   ASVVACVIVLLLWTASQGYRPLYGQQEKVETSQIIEVLEAEGINYRLEANSGLVLVQED
FT                   KLGKARMLLAARGVKAKVPSGMESLDNSGIGTSQFMEQAKYRHSLEGELSRTIMALKAV
FT                   RTARVHLAIPKRTLFIRQQPELPSASVMLDLYAGSKIQPGQIEAIANLVAGSVTGMTPE
FT                   RVQIVDQEGNHLSSGIAINQDITQARDRQLKYTQELEQSLINRASSMLAPVLGKENFQV
FT                   QIAAQVNFNQVEETRESLDPQSVVTQEKQSINDTNSDIAMGIPGALTNQAPKAQANKTE
FT                   ENTRRNLNQQESRQYEVGRSVRHTRFQQMQLENLSVSVLLNNQAAGENGWNEAQVSQLG
FT                   TMVKDSIGYSMQRGDQFSINSFDFAPVQIAQFEPMPWWQTEGYQAYLRYFIGGILGFGL
FT                   IFFVLRPLVSHLTRTAEHSLKEELPQVEPALEAPSSSSISGVQSGDGQALADQLMGLEQ
FT                   DKSDTDWLSNQGLPAPGSPLTVKMEHLSLLANQEPARVAEVIAHWIGDNENER"
     atgtctacaa cactcgctca acctagccca aatatgaccg atgtcagaga taagagtgaa        60
     atagtcagct ctttgaagac gaaatggcaa caatttaacc gtggtgatcg tcaggtatta       120
     gtgctggcaa ttctggcgag tgtcgttgct tgtgttatcg tgcttttact ctggacggca       180
     agccagggct atcgtcccct ctatggtcaa caagagaaag ttgaaacctc acagataatc       240
     gaagtcctcg aagccgaagg cattaattac cgactggagg ccaattcagg cttggtgctg       300
     gtccaggagg ataagctagg taaagcgaga atgttactcg ctgctcgtgg cgtaaaagct       360
     aaagtccctt caggtatgga atcgctggat aactcaggca ttggtaccag ccagtttatg       420
     gaacaggcaa aatatcgcca tagcctggaa ggcgagctgt ctcgcactat catggcatta       480
     aaagccgttc gcaccgccag agttcacctt gccattccta aacgaacctt gtttattcgt       540
     cagcaacctg aacttccatc ggcctctgtg atgctggacc tttacgcagg ctcaaaaatt       600
     caaccgggtc aaatcgaagc cattgcaaac ttagttgccg gaagcgtcac cggcatgacc       660
     ccggagcggg tgcagattgt cgatcaggag gggaatcacc ttagctcggg gatagcgatc       720
     aaccaagata ttactcaggc cagagatcgc cagctcaagt acacccagga gttagagcag       780
     agcctgatca accgagcatc aagtatgctg gctccagtgc tgggtaagga aaactttcag       840
     gttcaaattg ccgctcaagt taactttaac caggtcgaag agacccgtga atcactggat       900
     cctcaatcag tggtaaccca ggaaaagcaa agcatcaacg atactaacag tgatatcgcc       960
     atgggtattc ctggcgcact cacaaatcag gctccgaaag cgcaggcaaa taaaactgaa      1020
     gaaaacaccc gccgtaacct gaaccaacag gagagccgtc agtatgaggt tgggcgttcc      1080
     gtcaggcata cccgctttca gcagatgcaa ctggaaaacc tatccgtttc ggtactcctc      1140
     aataaccaag ccgccggtga aaatggatgg aacgaagctc aggtatccca gctgggcact      1200
     atggtaaaag attcgattgg ctactcaatg cagcgtggcg atcaattcag cataaacagc      1260
     ttcgattttg ccccggtaca gatagcccag tttgaaccta tgccctggtg gcaaacagaa      1320
     ggttatcaag cttacctcag gtatttcatt ggtggaattc ttggtttcgg gctcattttc      1380
     tttgtattgc ggccactcgt gtctcacttg acccgcacgg cagagcatag cctcaaagag      1440
     gagctgcctc aggtagagcc ggcactggag gctccaagct caagtagtat cagcggcgtt      1500
     caatccggcg atggtcaggc tctggcagat caattgatgg ggctcgaaca ggataagtct      1560
     gataccgact ggctcagtaa tcagggactg ccggcaccag gatcaccact cacggtgaag      1620
     atggagcacc tgagcctact cgctaaccaa gagcccgctc gtgtggctga ggttatcgct      1680
     cactggatag gcgataacga aaacgagaga tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page