(data stored in ACNUC7421 zone)

EMBL: CP000821.PE78

CP000821.PE78        Location/Qualifiers
FT   CDS_pept        complement(86938..87276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0078"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="KEGG: shw:Sputw3181_0462 flagellar hook-basal body
FT                   complex subunit FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34691"
FT                   /db_xref="GOA:A8FPB8"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB8"
FT                   /protein_id="ABV34691.1"
FT                   /translation="MSNSTLVNPQSMMDTLSIHSEMAKGAIKITPNPKDHGLQPASFTE
FT                   LMESKVAAVNLDQNTSSALMRAVDSGESDDLVGAMVASQKASLSFSTMIQIRNRLVQAF
FT                   DEVMKMPL"
     atgtcaaatt caaccttagt caaccctcag tccatgatgg acaccttgag tatccactct        60
     gagatggcta aaggggcgat aaaaataact cctaatccta aagatcatgg cttacagcca       120
     gcttcattta ctgaacttat ggagagtaaa gttgcggcag tgaatttaga tcagaatacc       180
     tcatcggctt tgatgagagc cgtggacagt ggcgaaagtg acgatcttgt aggagccatg       240
     gtggcatcgc aaaaagccag cctctccttt tcaaccatga tccagatccg taatcgctta       300
     gttcaggcct ttgatgaagt gatgaaaatg ccactgtag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page