(data stored in ACNUC7421 zone)

EMBL: CP000821.PE8

CP000821.PE8         Location/Qualifiers
FT   CDS_pept        7614..8696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0008"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: slo:Shew_0003 DNA replication and repair
FT                   protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34621"
FT                   /db_xref="GOA:A8FP48"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP48"
FT                   /protein_id="ABV34621.1"
FT                   /translation="MSLTRLHIETFRNITSAQLLPGEGINLIYGHNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVIQHSDDKLTLFANLNVLDKESKIGLRRFRSGETEVKIDGDKVKR
FT                   LSTLAESLPIQVITPESFALLFEGPKSRRQFIDWGAFHCDKSFHSAWVNVKRILKQRNQ
FT                   LLKNETSYSQIQFWDKELVRYSEVVTDIRTRYVNSLNEQLKGIIGEFLPLVDVKVSFTR
FT                   GWDSKTDYAQLLEMQYPRDLASGNTGSGPHKADLRLRVGTLPVQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQIDKNSIYLVDDLPAELDAKHRQLLLQQLIDTGAQVFVTAIEPAAILDS
FT                   LITPPSKTFHVEHGRVTVIE"
     atgagtctga cgcgtcttca tattgaaaca tttcggaata tcacttcagc tcaactactt        60
     cctggtgagg gaattaatct gatttatggc cataatggca gtggaaaaac cagtatttta       120
     gaggcgatct attttcttgg tatgggccgc tcttttcgca gccacctttc acaacgagtg       180
     attcaacatt cagatgataa gttgacactg tttgccaatt taaatgtgct cgataaagag       240
     agcaaaattg gattaagacg gtttcgaagt ggtgaaactg aggtcaaaat tgatggcgat       300
     aaagttaaac gcctgtcgac cttggctgag tctctaccca ttcaggtgat cactcccgag       360
     agttttgcac tgttatttga agggccaaaa tcgagacgtc aatttatcga ttggggtgcg       420
     tttcattgcg ataaaagttt tcattcggcc tgggtcaatg ttaagcgaat tttaaagcag       480
     agaaatcagc tacttaaaaa tgaaaccagt tactctcaaa ttcaattttg ggataaagag       540
     ttggttcgat attctgaagt cgttaccgat ataagaactc gatatgtaaa ctcgttaaat       600
     gagcaactta agggtataat tggggagttt ttacctctgg ttgatgtaaa ggtttccttt       660
     acccgaggct gggatagtaa aactgattac gcgcagttac tcgagatgca atatcccaga       720
     gatctcgcta gtggaaatac cggtagcggg ccccataaag ccgatctgag attacgtgtt       780
     ggtaccttac cggtacaaga tgcattatcc cggggccaat tgaaattgtt agtctgtgca       840
     ctgcgtatcg cacagggaaa gttgttaaaa caacaaatag ataagaatag tatttatctg       900
     gtggatgatc ttccagcaga gttggatgca aagcacagac agctgttgct gcagcagttg       960
     atcgacaccg gtgcacaagt atttgtcacc gccatcgagc ctgcagcgat actagattcg      1020
     ttaatcacgc cgccgagtaa gacgttccat gtggaacacg gtcgtgtaac ggtaattgaa      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page