(data stored in ACNUC7421 zone)

EMBL: CP000821.PE80

CP000821.PE80        Location/Qualifiers
FT   CDS_pept        complement(88607..89521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34693"
FT                   /db_xref="GOA:A8FPC0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR041544"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC0"
FT                   /protein_id="ABV34693.1"
FT                   /translation="MKISAHIKLYSLSFFLLISNIATASSTRYQTPLEQAKWDFTGNRF
FT                   ICQIEHKVNGFGEFKLIARPGTSLSLQLDADWLSFEQTTSQAKVVSPSWSQTDSLSSGA
FT                   THLKWHGRTAISDDTTSKFLEALEQGLAWQVLILARDGISYKVETSPINTQAIANKFKL
FT                   CRQELLPKPFSYVRRVDIQFESGTSKLTAAHEVDLEAIAQYVQADATVKEILVDAHADA
FT                   SGEHLANLVLSKERADEVASRLFELGIQKQKIQVRHHGARSPIVSNNSPEGREINRRVT
FT                   IRLIKSHTKTANSNPTGVNNASL"
     ttgaaaatct ctgctcatat aaaactctac tcactgtctt tttttctgct tatatcgaat        60
     attgcaacag caagtagtac ccgctatcaa actcctttag agcaggccaa atgggacttc       120
     accggaaatc gctttatttg ccagattgaa cataaggtaa atggctttgg cgaatttaaa       180
     ttgatcgcga gaccaggtac atctctgagc ctgcagctcg atgcagattg gctctccttt       240
     gaacaaacga cgagccaggc aaaggtggtt tctccgtcat ggagtcaaac cgatagctta       300
     agttccggag ctacccacct gaaatggcat ggtcgaactg ccatcagcga tgacacaaca       360
     agcaaatttt tagaagcctt agagcaaggg cttgcctggc aggtcttaat tctggcccgt       420
     gacggtatct catataaggt agaaaccagc cccattaata ctcaggctat tgcgaataag       480
     ttcaaacttt gtcgtcaaga attactgcca aaacctttct catatgttcg ccgtgtcgat       540
     atccaatttg aatcgggcac cagtaagctc accgctgcac acgaagtcga tttagaggct       600
     attgcacaat atgttcaagc cgatgcgaca gtgaaggaaa ttttggtcga tgcacacgcc       660
     gatgcttccg gtgagcactt agccaatttg gtattaagca aagagagagc cgacgaggtg       720
     gcatcccgtc tatttgagtt gggcattcag aaacaaaaaa ttcaggttcg ccatcatggt       780
     gcccgctctc caatagtcag taataacagc cctgaaggaa gagagataaa tcgcagggtc       840
     acgattcgtt taattaagtc ccacactaag actgcgaaca gtaacccaac cggagttaac       900
     aatgcctctc tctaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page