(data stored in ACNUC7421 zone)

EMBL: CP000821.PE81

CP000821.PE81        Location/Qualifiers
FT   CDS_pept        90188..91054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34694"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC1"
FT                   /protein_id="ABV34694.1"
FT                   /translation="MKTTAKACLLKASRCERVRPVALIQEKLARSRLLIQVDACQRSFL
FT                   EAANGVLNPIIRQGHHALSSISLTDSDQSVVPDINNGWFLLRYQRLPLAWWRIDKCTLD
FT                   QLASGYYGSLATLLKSPLRAPSQSEFRLAKKLMLAALKVLPTAELDENALELELVVNST
FT                   PIDSPVIWEIAFPVEHKVAPMLFCMTEHLLGLMSEQPSQYMATPDLAEKLSYRLRQIPI
FT                   KILFELGRQSTPVTSLHGLEVGDILPMNLHSRCPVTVGKRPLFYAAIHTHDGQMVAKLA
FT                   QDIYQQG"
     atgaaaacaa cggcgaaagc atgtttactt aaagcttctc ggtgtgagcg ggttagacct        60
     gttgcattaa ttcaggagaa gttagcccgt agtcggttat tgattcaagt tgatgcttgt       120
     cagcgctcct ttcttgaggc ggctaatggg gtgctcaacc ccattatcag acagggtcat       180
     catgcgttat cgagtatttc attgaccgac agtgatcagt ccgtggtacc cgatatcaat       240
     aatggctggt ttctacttcg ttatcagcgg ctgcctttgg cgtggtggcg aatcgataaa       300
     tgtactctgg accaattggc tagtggctat tatggaagtc tggcgactct cttgaagtct       360
     cctttgcgag cccccagcca atcggagttt agattggcaa aaaaattgat gcttgccgcg       420
     ctcaaggttc tgcctacagc agagcttgat gaaaatgcat tagagctgga gttggtggtc       480
     aatagtacgc ctatcgattc acctgtgatt tgggagatag cttttccggt agagcataag       540
     gtggctccta tgttgttttg tatgactgaa cacctactgg gattaatgtc tgagcagcct       600
     agccaataca tggcaacacc tgatttagcc gaaaagctct catatcgcct gaggcagatc       660
     cccataaaga tattgtttga acttggtcgt caaagcacgc cggtgacttc acttcatggc       720
     cttgaagttg gtgacatatt acccatgaat ttacattctc gctgcccggt aacagtggga       780
     aagcgacctc ttttttacgc tgcaattcat acccatgatg gccagatggt tgccaaatta       840
     gcccaggata tttatcagca aggatag                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page