(data stored in ACNUC7421 zone)

EMBL: CP000821.PE82

CP000821.PE82        Location/Qualifiers
FT   CDS_pept        91135..91491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0082"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="KEGG: shw:Sputw3181_0459 flagellar motor switch
FT                   protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34695"
FT                   /db_xref="GOA:A8FPC2"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC2"
FT                   /protein_id="ABV34695.1"
FT                   /translation="MTEHTMLQDDDFLLDDNLFGEEEAVQEMSSPKPVKDISFFHQLPV
FT                   QVTLELASAEMSLGELTRMGEGDVVALDRMVGEPLDIRVNGALLGRGEVVEVNGRYGVR
FT                   LLEVEAISLTGAND"
     atgacagaac atactatgtt acaagacgat gattttttat tggatgataa tctttttggt        60
     gaagaggagg ctgttcaaga gatgagtagc ccaaaacccg ttaaagatat ctcattcttt       120
     catcagttgc cggtacaggt gacgttagaa ttggcgagtg ccgagatgtc tctgggagag       180
     ctgactcgaa tgggagaggg tgatgtagtt gctctcgatc gcatggtagg agagccatta       240
     gatatacgtg ttaatggtgc tttgctcggc agaggggaag tggttgaagt taatggccga       300
     tatggagtgc gtttattgga agttgaagcc atcagtctaa ccggggcgaa tgactga          357
//

If you have problems or comments...

PBIL Back to PBIL home page