(data stored in ACNUC7421 zone)

EMBL: CP000821.PE83

CP000821.PE83        Location/Qualifiers
FT   CDS_pept        91494..92222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0083"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: sdn:Sden_3664 flagellar biosynthetic protein
FT                   FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34696"
FT                   /db_xref="GOA:A8FPC3"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC3"
FT                   /protein_id="ABV34696.1"
FT                   /translation="MLRALLLLFCLLAPSAFANDGFTLFTLDDGQQSQSVNIKLEILAL
FT                   MTVLSFLPALLMMLTSFTRIIVVLAILRQALGLQQSPPNKVLLGIALVLTLFVMRPVGQ
FT                   VMYDEAYLPYDQGLIELPEAVNIGVVPLRKFMLAQTRETDLEQMLKIADEPVTLTADEI
FT                   PFFVLMPAFVLSELKTAFQIGFLLFLPFLVIDLVVASVLMSMGMMMLSPLIISLPFKLM
FT                   VFVLVDGWSMTVSTLVASFG"
     atgcttcgag cactgttgct tctcttttgc ttactggcac cgagtgcatt tgcaaatgat        60
     ggttttacgc tatttacctt agatgatggc cagcaaagtc aatcggtcaa catcaagcta       120
     gagatcctgg ccctgatgac agtgctgagt tttctacccg cactgttaat gatgctgacc       180
     agttttaccc gcatcattgt ggtgctggct attttgcggc aggcactggg tctgcaacag       240
     agtccgccta acaaggtgtt actcggcatc gctttagtgc tcaccctatt cgtgatgaga       300
     cctgtgggtc aggttatgta tgatgaggct tatctgccct atgatcaggg gctgatagag       360
     ttacccgagg cggtcaatat tggtgtcgta cctttgcgta agtttatgtt ggcgcagact       420
     cgggaaaccg atcttgagca gatgctaaaa atcgcagatg aacccgtgac actcacggcc       480
     gatgagatcc ccttctttgt gcttatgccg gctttcgtgt tgagtgagct taaaaccgcc       540
     ttccagattg gtttcctcct gttccttcct tttcttgtta tcgacttggt ggtagccagt       600
     gtgctgatgt cgatggggat gatgatgctt tcgcctctga ttatctcatt gccttttaag       660
     ttgatggtgt tcgtcctggt ggatggctgg tctatgacgg tcagtacgtt agttgccagt       720
     tttggatag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page