(data stored in ACNUC7421 zone)

EMBL: CP000821.PE84

CP000821.PE84        Location/Qualifiers
FT   CDS_pept        92434..92703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0084"
FT                   /product="export protein FliQ, family 3"
FT                   /note="KEGG: sbl:Sbal_3985 export protein FliQ, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34697"
FT                   /db_xref="GOA:A8FPC4"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC4"
FT                   /protein_id="ABV34697.1"
FT                   /translation="MEVNELTSIFSDAIYLVVAMVGVLVVPSLLVGLIIAVFQAATQVN
FT                   EQTLSFLPRLVLTLLMVLFSGQWLLQQISDLFDRLFMNIPHIIG"
     atggaagtta acgagctgac ctctatcttt tccgatgcca tctatttggt ggttgccatg        60
     gttggcgttt tggttgttcc tagcctgttg gtgggattga ttattgcggt gtttcaggcg       120
     gcgacacaag ttaacgagca aacgctcagt ttcttaccca gactggtgct gactctctta       180
     atggtgttgt tctccggaca gtggctattg caacagatct cagatctgtt tgatcgcctg       240
     tttatgaaca tcccccacat cataggttaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page