(data stored in ACNUC7421 zone)

EMBL: CP000821.PE85

CP000821.PE85        Location/Qualifiers
FT   CDS_pept        92706..93479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0085"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="KEGG: sbl:Sbal_3986 flagellar biosynthetic protein
FT                   FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34698"
FT                   /db_xref="GOA:A8FPC5"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC5"
FT                   /protein_id="ABV34698.1"
FT                   /translation="MLSLTSAQLSSFIGIFWWPFFRIMGAFMVMPFLSSSYIPVTVRVL
FT                   LALTISTLLAPMLPPLPSVDAISIGALFLAIEQLLVGFMLGLFLTIMIHVMTLLGAMMS
FT                   MQMGLAMAVMNDPANGSSNPILGQWFLLYGTLLFLALDGHLVAIGVLVDSFRLWPIGSG
FT                   VLDLPLMGLVSRFAWIFASALMLALPSILAMLMVNITFGVLSRAAPSLNVFALGFPMSM
FT                   LMGLLCVMLSFSGLPTRYSDICLDALEAMYQFIGG"
     atgctgtctc tgacctcggc tcaactcagc tcatttatcg gtattttctg gtggccattt        60
     tttcgtatta tgggcgcgtt tatggtgatg ccatttttga gcagcagtta tattcccgtt       120
     acggtaaggg tattgctggc actcacgatt tcaaccttgc tcgctcccat gttaccgcct       180
     ctacccagcg tcgatgccat ctctatcggg gcactgtttc tggcgatcga gcagttgctg       240
     gtcgggttta tgttggggct atttctgacc ataatgatcc atgtgatgac gctgctaggt       300
     gccatgatgt ccatgcagat gggactggct atggctgtga tgaatgaccc ggctaacggc       360
     agctccaatc ctattttggg gcagtggttt ctgctgtatg gcacgttact ctttcttgct       420
     ctggatgggc acctggtcgc gataggtgta ctcgtcgata gttttcgtct ctggcccatt       480
     ggttccgggg tattagatct tcctctcatg ggactcgtta gccgctttgc ctggatcttt       540
     gcatcggctc tgatgttagc cttgccctct atcttagcca tgttgatggt gaatattacc       600
     tttggtgttc tgagtcgcgc cgccccatct ttgaatgtat ttgcattagg ctttcccatg       660
     tcgatgctga tgggattgct gtgcgtaatg ctctctttta gtggtttgcc tacccgttac       720
     agcgatatct gtctcgatgc gctcgaagct atgtatcaat ttatcggtgg ttaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page