(data stored in ACNUC7421 zone)

EMBL: CP000821.PE86

CP000821.PE86        Location/Qualifiers
FT   CDS_pept        93496..94626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0086"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="KEGG: sdn:Sden_3667 flagellar biosynthetic protein
FT                   FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34699"
FT                   /db_xref="GOA:A8FPC6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC6"
FT                   /protein_id="ABV34699.1"
FT                   /translation="MSKDTGQSKTEKATPQKLKKAQDQGQVPRSKDLAATALIIGCSLM
FT                   LTASADWFATRVARVAQYNMSLTKAELDEPGMMMSHLGTSLVEILNILGPIIVLIAVLA
FT                   MVAGSMPGGPVFNFKNAAFKYSRIDPIAGIGRMFSMKSLVELVKSILKIVLLIGIMFTF
FT                   LEHNLQSLLGYSQLPIDEAVRKGIDILSLGMLYLGIGMLVITFIDVPYQYWHHHNELKM
FT                   SRQDVKDEHKQQEGKPEIKAKIRQLQQRIGRSRADVAIPQADVLLVNPNHYAVALKYDV
FT                   EKADAPYVLTKGTDELALYMRQIAKHHDVEVIELPPLARAIYYSTQVEQQIPAALFIAI
FT                   AHVLSYVLQIKAARQGKQQRPDPLPNFFIPPHLRRD"
     atgagtaaag ataccggtca gagtaaaacg gaaaaggcga ccccgcagaa actcaagaag        60
     gcacaggatc aggggcaggt tcccagatcc aaagatctcg cggctacagc cttaatcata       120
     ggttgctccc tgatgctgac ggcgagtgca gactggtttg ccacacgggt tgcacgggtg       180
     gctcagtaca atatgtcact caccaaggct gaattggatg agcctgggat gatgatgagc       240
     cacttaggca cctccttggt ggagatcctc aacattttgg gccccattat tgttttgatc       300
     gcagtactgg ccatggtggc gggatctatg cctggtggac cggtttttaa ttttaaaaat       360
     gccgcattca aatacagtcg catcgacccc atagctggca tagggcggat gttctcgatg       420
     aagtctctgg ttgagctggt gaagtcgata cttaaaattg tcttgctgat cggcatcatg       480
     tttaccttcc tcgaacataa cctgcaaagc ctgttgggct atagccaact tccaatcgat       540
     gaagccgtac gtaaggggat cgacatcttg tctttgggaa tgctctattt ggggataggc       600
     atgctggtga tcacctttat cgacgttcca tatcagtatt ggcaccacca taacgagttg       660
     aagatgtccc gccaggatgt gaaagatgag cacaagcagc aggaaggaaa gccagagatt       720
     aaggcgaaaa ttcgtcagtt acaacagcgc atcggccgtt ccagggccga tgttgcgatc       780
     ccacaagccg atgtcttgct ggttaacccc aaccattatg ctgtcgcgct taaatatgat       840
     gtcgaaaaag ccgatgcacc ttacgtgctc actaagggaa cagatgaact ggcgttatat       900
     atgcgccaga ttgccaaaca tcatgatgtt gaagtgatcg aactgccgcc attggcgcgt       960
     gctatctact actcgaccca agtcgagcag cagatcccgg ccgccctgtt tattgccatc      1020
     gctcatgtgc tcagctatgt gttgcagatt aaggctgcgc ggcagggtaa gcagcaaaga      1080
     ccagacccgc tacctaattt ctttattccg ccccatctac gtcgtgacta a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page