(data stored in ACNUC7421 zone)

EMBL: CP000821.PE87

CP000821.PE87        Location/Qualifiers
FT   CDS_pept        94830..96911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0087"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="KEGG: shw:Sputw3181_0454 flagellar biosynthesis
FT                   protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34700"
FT                   /db_xref="GOA:A8FPC7"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC7"
FT                   /protein_id="ABV34700.1"
FT                   /translation="MNWLSRTFAGNRSYIGIPIMLLAILAMVILPLPPWLLDILFTFNI
FT                   VLAVMVLLVSVSIRRPIDFSVFPTVLLLATLMRLTLNVASTRVVLIEGHQGGDAAGRVI
FT                   QAFGEVVINGNYVVGGVIFLILMIINFVVITKGGERISEVSARFTLDALPGKQMAIDAD
FT                   LNAGVLSQEQARVRRQDVAREADFYGSMDGASKFVRGDAIAGLMILAINILGGIAIGVF
FT                   MHGLSAGEAFRTYALLTIGDGLVAQIPSLLLATAAAIIVTRVSDAEEMPTQLSKQLLAN
FT                   PKTLATAAAVMTILGLVPGMPAFVFLSFAALLGFAAWKQSQGRSVQPETEVEEQLEKSL
FT                   SEPSAPSWDALPFTDLIEVRLGYRLVHLVERSKGAELQKRLTGIRRTLSEQAGFLLAEV
FT                   RVRDNLALAPNAYQINLMGNPVVTAELEPERMMAIKSGPVFGDIDGVITKEPAYNMDAT
FT                   WIEPELKAKALNLGYSVVDNATVIATHVSKLIRESLPDMLQHDDVIALSDRLAKQSPKL
FT                   AESLSTALTPIQQLKVYRLLLKEQVSLKDIRTIATTLLDCSENSKDPVLLAADVRCALR
FT                   NSILHSIAGSAPQINVLTLAPELEQTLMTALNQSQQQGKVALDSFPVEPQLLAQLQQKM
FT                   PQILADAKEQGHSPMLLVSPQLRPILARYALAFARGLHVLSYNEIPETRELMVAGQLG"
     atgaactggt tatcgcgcac ttttgcaggc aatcgcagtt atatagggat ccctatcatg        60
     ctgctagcca ttcttgccat ggttattctt ccactgcctc cttggttgct ggatatcctg       120
     tttaccttca acattgtgct ggcggtgatg gtgttgcttg tcagtgtttc catcaggcgt       180
     cccatcgact tttcggtctt tccgacagtg ctcttgttag ccaccttgat gcggttaacc       240
     ttgaatgtgg cttcgacgcg tgtggttctc atcgaaggac atcagggggg agacgccgca       300
     ggacgtgtga tccaggcgtt tggtgaggta gttatcaatg gtaactatgt cgtcggtggg       360
     gtgatcttct taatcttgat gattattaac tttgtggtga tcactaaagg tggagagcgg       420
     atctctgagg tatcggctcg ctttactctc gatgcgcttc ctggcaagca gatggctatc       480
     gatgcggatc tcaatgcggg ggtcttgagc caggaacaag cgagagtacg tcgtcaggat       540
     gtcgcccgtg aagccgattt ctatggttct atggatggtg catctaaatt tgttcgtggt       600
     gatgccattg caggtttaat gatcttggcc atcaatattc ttggcggtat cgctattggt       660
     gtcttcatgc atggtctgag tgcaggagag gcattcagga cttacgccct gctgaccatt       720
     ggtgatggac tcgttgccca aattccttct ctgttgttgg ctactgcggc ggcgattatc       780
     gtgacgcgag tctccgatgc cgaggagatg ccgactcaac tgagtaagca gttgttggct       840
     aaccctaaga cgttggctac cgctgcggcg gtgatgacta tcttgggttt agtaccgggc       900
     atgcctgctt ttgtcttcct ctcatttgcc gccttgttag gttttgcagc ctggaagcag       960
     agccagggaa ggtcggtcca gccagaaact gaagttgaag agcagttgga gaagagtctg      1020
     tcagagcctt cggccccaag ctgggatgca ttgccgttca ccgatcttat cgaggtgcgc      1080
     ttgggttacc gcttagtaca cctggttgag cgcagcaagg gcgccgagtt gcaaaaacga      1140
     ctgacgggaa tcaggcgaac cttgtctgag caagcgggat ttttactcgc agaagtcagg      1200
     gtcagggata atttagcctt agcgcccaat gcttatcaaa ttaacctgat gggcaaccca      1260
     gtggtgaccg cggagctgga accggagcga atgatggcca ttaagagtgg tccggttttc      1320
     ggtgatatag atggtgtaat aaccaaggaa cctgcctaca acatggatgc gacctggatt      1380
     gagccagagc taaaggctaa ggctttaaat ctggggtatt cggttgtcga taatgccacc      1440
     gttatcgcga cgcatgtgag taagcttata cgtgaatctt taccggatat gctgcaacat      1500
     gatgatgtta tcgccttgag cgatcgcctc gcgaaacagt cacctaaatt ggccgaatct      1560
     ttaagtacgg cattgacccc aatccagcag cttaaggtgt atcgtctgtt gttgaaagag      1620
     caggtgtcgc tgaaagatat tcgcaccata gcgacgaccc tgctcgattg cagtgaaaac      1680
     agtaaagatc ctgtcctgtt ggccgccgat gtacgttgtg ccctccgtaa tagtattctt      1740
     cactctatcg caggctcagc tccgcagatc aatgtattga ccttggcacc ggagctggag      1800
     cagaccttga tgaccgcgct taaccagtct cagcagcagg ggaaggttgc actggacagt      1860
     tttccggtag agccgcagct gctcgcacag ttgcagcaga agatgccgca aatattagcg      1920
     gatgccaagg agcagggtca tagccctatg ttgctggtat cgccacaact caggcctatc      1980
     cttgcccgat acgcattggc ttttgccaga gggttacatg tgctctcata caatgagatc      2040
     ccagagactc gggagttgat ggtcgcgggg caacttggct ag                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page