(data stored in ACNUC7421 zone)

EMBL: CP000821.PE89

CP000821.PE89        Location/Qualifiers
FT   CDS_pept        complement(98169..99968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0089"
FT                   /product="protein of unknown function DUF885"
FT                   /note="KEGG: sbl:Sbal_0045 protein of unknown function
FT                   DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34702"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC9"
FT                   /protein_id="ABV34702.1"
FT                   /translation="MYKILVPSLLAFSLSACQLNLVNTDQPQAPDIPVETQASTQLQGL
FT                   IEKSWLITLDASPDFAYSQGNLDKAGQLTDLSPLALANLNKRRQVILYSLMALDRGPLT
FT                   KEEKINAQILQDQLQNNVDLYRYKDHYLPISSESGFHAYIASIAKARFATERDYGNYIA
FT                   KLKALPTYFAQQTHWLQQGLDSGITPPKITLKGFEESISAFIVPVEQSGYFKPFTQYPK
FT                   HFTDSQKTALTQEGHDLVQNTVLPLYRQFYDFMTLSYIPGARTSIATASLPDGEAFYEN
FT                   RVRYYTTLNMNSDQVHQLGLKEVKRIRAEMETIINEVGFKGSFADFLHFLRTDPQFYPT
FT                   TAEELLKEAAYIAKKADAMLPKYFGKLPRTPYGIQEVPAEIAPKYTTGRYSGSNRDDEP
FT                   GYYWVNTYALDKRPLYEMEALTLHEAVPGHHLQISLNTELTSLPNFRRYSYISAFGEGW
FT                   GLYSEYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAKGWSRQQALDFMASNTA
FT                   LSMHNVTTEIDRYISWPGQALSYKIGELTIKRLRAKAEDALGEEFDIRAFHDAVLENGS
FT                   VPMQVLEQQIDDFISAQKAIKGS"
     atgtacaaaa ttttggtacc cagcctactt gccttcagct taagtgcctg ccagctaaac        60
     ctagtcaata ccgaccagcc acaggctccg gatattccgg tcgagacaca agccagcacg       120
     cagttgcaag gcttgataga aaagtcatgg ctaatcacat tagatgccag tccggatttc       180
     gcctactctc aaggcaactt agataaggcg ggacaactga ccgacctgtc ccctctggct       240
     ctggctaacc tcaacaagag gcgacaggtg atactctact cactaatggc actggataga       300
     ggtccgctga caaaagagga aaaaattaac gcgcagatat tgcaagatca gctgcaaaac       360
     aacgtcgacc tctatcgtta taaagatcac tacctcccta tctcttctga gagtggtttt       420
     catgcctata tcgcctcgat agctaaggct cgttttgcaa ctgagcggga ctatgggaac       480
     tacatcgcca aactaaaagc attgccaacc tacttcgctc agcagactca ttggttacaa       540
     cagggattag atagtgggat cacaccgcct aaaataacgc tcaaggggtt tgaagagagc       600
     atcagcgctt ttatcgtacc ggtcgaacag agtggttact ttaaaccttt cactcagtac       660
     ccaaagcatt tcactgactc acagaagacg gcattgaccc aggagggtca tgatctggtt       720
     cagaataccg ttctccccct gtatcgacag ttctatgatt ttatgaccct gagctatatt       780
     cccggggccc gtaccagtat cgcaactgcc agccttcccg acggtgaagc cttctatgaa       840
     aaccgggtca ggtactacac caccctgaat atgaactcag atcaggtcca ccagctggga       900
     ttaaaagagg tcaaacgtat ccgggctgag atggaaacga ttatcaacga agtaggcttt       960
     aagggttctt ttgcagattt cctccatttc ctcagaaccg atcctcaatt ctacccgacg      1020
     actgccgagg agctcttaaa agaggccgct tatattgcta agaaggccga tgccatgctg      1080
     ccaaagtatt ttggcaagct cccccgcact ccctatggca ttcaggaagt tccggccgag      1140
     atcgcaccaa aatacaccac gggacgctac tccggctcca acagagacga tgaacccggc      1200
     tattactggg tcaacaccta tgcgctggat aagcgaccgc tgtacgagat ggaggccctc      1260
     acccttcatg aagctgtgcc gggacaccac ctgcagatat ccctcaatac agaactcact      1320
     tcgctaccta actttcgccg ctatagctat atatcggcat ttggcgaagg gtgggggctc      1380
     tactccgagt atcttggttt agaagcgggt ttctaccaag atccctacag taattttggt      1440
     cgtctaacct atgagatgtg gcgagcggcc agattagttg tcgatacagg catgcacgcc      1500
     aaggggtgga gtcgccaaca ggccctggac ttcatggcca gtaacaccgc cctctctatg      1560
     cataatgtca ccacggagat agacaggtat atctcctggc cgggacaggc gctgtcatac      1620
     aagattggag agctcaccat aaaacgcttg cgagccaaag cggaggatgc actgggagaa      1680
     gagtttgata tcagggcctt ccacgatgcg gtcctggaaa atggctcggt gccgatgcag      1740
     gtgctggagc agcagataga tgactttatc tcggcccaga aagcgataaa gggcagctaa      1800
//

If you have problems or comments...

PBIL Back to PBIL home page