(data stored in ACNUC7421 zone)

EMBL: CP000821.PE9

CP000821.PE9         Location/Qualifiers
FT   CDS_pept        8689..11130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0009"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: slo:Shew_0004 DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34622"
FT                   /db_xref="GOA:A8FP49"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP49"
FT                   /protein_id="ABV34622.1"
FT                   /translation="MNNRRENNMSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGL
FT                   HHMVFEVVDNSIDEALAGHCNDVIITIHADGSVSVKDDGRGIPVAIHPEEGISAAEVIM
FT                   TVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSHKLQLTIRRDGKLYEQFYTHGEPDEPI
FT                   KAIGDATNTGTEIRFWPSTDTFTDVLFHFDILAKRVRELSFLNSGVGVRLVDERDNRDE
FT                   FFKYDGGISAFVDYLNVNKTPVNKEVFHFIQERDDGITVEVAMQWNDGFQENIFCFTNN
FT                   IPQRDGGTHLAGFRGALTRNLNTYMEREGYNKKGKTGATGDDAREGLTAVISVKVPDPK
FT                   FSSQTKDKLVSSEVKSAVEQTMGEQLGDYLMEHPNEAKLIVGKIIDAARAREAARKARE
FT                   MTRRKGALDLGGLPGKLADCQEKDPALSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGK
FT                   ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYDPDKTRYHNIVIMTDADVDGSHIRT
FT                   LLLTFFFRQMPELIERGFVYIAQPPLYKVKKGKQEQYLKDDPALTEFLTNLALDGGEIH
FT                   ASANAPAMSGAPLEKLVYQYREVEAIFDRLDQRYPLMLTERMLYHPALSNDVLADEAKV
FT                   QQWCDAYVADLAEKESGGYIFSGEAFLEPERQVYLPKITIRKHGIDTHYLFSYDFLQSS
FT                   DYERMAKLATALDGLIEEGGYVKRGERLKEVSSFVEALDWLMNDSRRGLYIQRYKGLGE
FT                   MNPEQLWETTMDPESRRMLVVTIEDAIAADQLFTCLMGDQVEPRREFIESNALNVANLD
FT                   V"
     ttgaataacc gacgagagaa taatatgtca gagaacagtt acgattcttc cagtattaag        60
     gtactaaaag gccttgatgc agtacggaag agacccggga tgtatatcgg tgataccgac       120
     gacggcactg gtctacatca tatggtattc gaagtagtcg ataactcaat cgatgaagcc       180
     ttagcgggcc attgtaatga cgttatcatc actatccatg ccgatggttc tgtatcggta       240
     aaagatgatg gtcgtggtat tcctgttgcg attcaccctg aagagggcat atctgcagcc       300
     gaagttatta tgacggtact ccatgccggc ggtaagttcg atgataactc atacaaagtg       360
     tctggtggtc ttcacggtgt aggtgtttct gttgtaaatg cactatctca caagctacag       420
     ctgactattc gtcgtgacgg taagctttat gagcagtttt acactcatgg tgagccagat       480
     gagcccatta aagctatcgg tgatgcaacc aatactggta cggagattcg tttctggcca       540
     agtacagata ccttcaccga tgtattgttc catttcgata tcttagccaa gcgtgttcgt       600
     gaactttcgt tcctaaactc cggtgtaggt gttcgtcttg tcgatgagcg tgataatcgt       660
     gatgagtttt tcaaatacga tggtggtatc agtgccttcg ttgattactt gaacgttaac       720
     aagactccgg taaacaaaga agttttccac ttcatccaag agcgcgatga cggtattacc       780
     gtagaagttg ctatgcagtg gaatgatggt tttcaggaga atatcttctg ttttaccaac       840
     aacattcctc agcgtgatgg tggtactcac cttgctggtt tccgcggtgc tttgacccgt       900
     aacctaaaca cctatatgga gcgtgaaggt tacaataaga agggtaagac tggcgcgacc       960
     ggtgatgatg cccgtgaagg tctgacagca gttatctctg ttaaagttcc agatcctaag      1020
     ttcagttctc agactaaaga caagctggtt tcgagtgaag tgaagtctgc tgttgagcaa      1080
     acaatgggtg agcagttagg tgattacctg atggagcatc caaacgaagc taaattaatt      1140
     gtcggtaaga ttattgatgc ggctcgtgct cgtgaagcgg cgcgtaaagc ccgtgaaatg      1200
     actcgtcgta aaggcgcgtt agatctgggt ggtctgccag ggaaacttgc cgattgccaa      1260
     gagaaagacc ctgcgctttc tgaaatatac atagtggaag gagactctgc tggcggtagc      1320
     gccaagcagg ggcgtaaccg taagaaccaa gcgattctgc cacttaaagg taagatttta      1380
     aacgttgaga aggcacgttt cgataagatg ctctcttctc aagaagtggc aacgcttatc      1440
     actgcactag gttgtggtat tggccgtgat gaatacgatc cggataaaac gcgttaccat      1500
     aacatcgtca tcatgaccga tgccgacgtc gatggctcgc acatccgtac cttgctattg      1560
     accttcttct tccgtcaaat gcctgagctc atcgagcgtg gctttgttta tattgcccag      1620
     ccaccgcttt ataaagttaa gaaaggtaag caagaacagt accttaaaga tgacccagca      1680
     ttgactgagt ttttgactaa tttagcgtta gacggtggtg aaatccatgc gtctgccaat      1740
     gcgccggcca tgtctggcgc accactagag aagctggttt atcagtatcg tgaagttgaa      1800
     gctatctttg accgcttaga tcagcgctac ccattgatgt taactgagcg catgctatat      1860
     cacccagcat tgagtaacga tgttttagcc gatgaagcta aggttcagca gtggtgtgat      1920
     gcctatgttg ccgatctggc agagaaagag tctggtgggt atatctttag tggagaagcc      1980
     ttcctggagc ctgaacgtca agtgtatctt cctaagatca ctattcgtaa gcacggtatc      2040
     gatactcact atctgttctc gtatgacttc ctgcagtcga gcgattatga gcgtatggca      2100
     aaacttgcta ctgcgcttga tggcttaatt gaagagggcg gctatgttaa acgtggtgag      2160
     cgcctgaaag aagtttccag cttcgttgag gcactcgatt ggttaatgaa tgactccagg      2220
     cgtggtcttt atatacaacg atacaaagga ttgggtgaga tgaacccaga gcaattatgg      2280
     gaaaccacca tggatcctga gtctcgtcgt atgctagtgg ttacgattga agatgcgatt      2340
     gctgccgatc agttgtttac ctgcttgatg ggcgatcagg ttgagccacg tcgtgaattt      2400
     atcgaatcaa atgcgctgaa cgtagctaac ttggatgtct ag                         2442
//

If you have problems or comments...

PBIL Back to PBIL home page