(data stored in ACNUC7421 zone)

EMBL: CP000821.PE91

CP000821.PE91        Location/Qualifiers
FT   CDS_pept        complement(101794..102273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34704"
FT                   /db_xref="GOA:A8FPD1"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD1"
FT                   /protein_id="ABV34704.1"
FT                   /translation="MTTALLILGFIIVMTLAAYATALLLKLRKQTAQRLKRQQELDEIN
FT                   RARVDEHLDSIRYIATAMLEERCELSEGVMRIAKLFGILSMSEQVAPQFPAIFKHFEII
FT                   EEHPIMAERKQLEKKQRMKLDFARMRSEAELETAILEEAKQLVTYSQTEIPTHLH"
     atgacgacag cgcttctcat cttaggtttc atcatcgtta tgaccttagc cgcttatgcc        60
     acggcattat tactcaagct tcgtaaacaa accgcacagc ggttaaagcg acagcaggag       120
     ctggacgaaa taaacagagc cagagtcgat gagcacttag atagcatacg ctatattgct       180
     acggccatgt tagaggagag gtgtgagcta tctgaaggcg taatgagaat agcaaagtta       240
     tttggcatac tctcgatgtc tgaacaggtt gcgccacagt ttccagcaat ttttaagcac       300
     ttcgaaataa tcgaagaaca ccccatcatg gccgaaagaa agcagcttga gaagaagcag       360
     cgaatgaagt tagatttcgc tcgtatgcgt tcggaagcag agcttgaaac cgccattctt       420
     gaggaagcta aacagttggt gacatacagc caaacagaga tcccgacaca tttacattag       480
//

If you have problems or comments...

PBIL Back to PBIL home page