(data stored in ACNUC7421 zone)

EMBL: CP000821.PE92

CP000821.PE92        Location/Qualifiers
FT   CDS_pept        complement(102406..102942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34705"
FT                   /db_xref="GOA:A8FPD2"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD2"
FT                   /protein_id="ABV34705.1"
FT                   /translation="MAHSKKSRKTDQNAPKLAPRSKKNERVLAGKKKETGNKAGSRHNS
FT                   NLVGGTQGSAAQKKDPRHGSKTAVKLDLPGQTIAPKKEKGPKLTDEQRLFKLEEDPRLN
FT                   QLLDMLEEGKDLNEEDQKWLNKQLNTIESLMERLGITEQDDLDHAMKSAVASSDDDLLD
FT                   KFESGADLLKDYQDK"
     atggcacact ctaaaaaatc gcgtaaaacc gatcaaaatg caccaaagtt agcaccaaga        60
     tccaaaaaga atgaacgcgt tctggctggc aaaaagaaag agactggaaa taaagctgga       120
     agccggcaca actcaaatct ggtcggtggc actcaaggct ctgcagcaca gaaaaaagat       180
     ccacgtcatg gcagcaaaac cgcggtcaaa ctcgatcttc caggtcaaac catcgcgccg       240
     aagaaagaga aaggtccaaa gctgaccgat gaacaacgtc tgtttaagtt agaggaagat       300
     ccaagactaa accaacttct ggatatgctg gaagagggga aagacttaaa cgaagaagat       360
     cagaagtggc ttaacaagca actcaatact atcgaatcac tcatggaacg tttagggatc       420
     accgagcaag atgatcttga ccatgccatg aagtcggcag tagccagcag cgatgatgac       480
     cttctcgata agttcgaatc gggtgccgat ctgcttaaag attaccaaga taagtaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page