(data stored in ACNUC7421 zone)

EMBL: CP000821.PE93

CP000821.PE93        Location/Qualifiers
FT   CDS_pept        complement(102991..103689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34706"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD3"
FT                   /protein_id="ABV34706.1"
FT                   /translation="MVNRSITMRRCPLCHNQHSSVFHQDRKRNMYLCDRCQLVFSDANS
FT                   HLPPPVEKRRYQQQVAKNQKPLKQFLMSLILQCEQQSTDPLIGLNFGRVAEPDTVLSVE
FT                   SHRHTLYQYDPYFAANHDLLKRQYDFICCYRVFEHFRFPFKEWSLLGKLLKPGAWLAIS
FT                   TKLLTELSAFDRWHHKNNLTHVSFYQHSTFEFLAQQAGFKLLFAANDLILVQKPSGSDI
FT                   KRDQSSLDDV"
     atggtgaacc gatctattac aatgcgtaga tgccccctgt gccacaatca acactcctct        60
     gtgtttcacc aagatagaaa acgcaatatg tatctctgcg accggtgtca actcgtcttc       120
     tccgatgcca actcacatct ccctcccccg gtagaaaagc gcagatatca acaacaggtc       180
     gcaaagaatc aaaaaccttt aaagcagttc ttgatgagtt tgatacttca atgtgaacag       240
     cagagcacag atccgctgat tggcctgaac ttcggaagag ttgccgagcc tgacacggtt       300
     ttgagtgtag agtctcatcg gcacacccta tatcaatatg atccatattt tgcagccaac       360
     catgacctgc tcaagcgcca atatgacttt atatgttgct accgggtttt tgaacatttt       420
     cgctttccat ttaaagaatg gtctttgctc ggcaagctac tgaagccagg ggcctggtta       480
     gccatcagta ccaagttact caccgaattg agtgcatttg acagatggca ccacaagaat       540
     aacctgaccc atgttagctt ttatcagcac tcaaccttcg agtttctagc ccaacaggca       600
     ggttttaagc tattattcgc agcaaatgat ctcattctgg tgcaaaaacc atcaggatct       660
     gatataaaac gcgaccaaag ttcgcttgat gatgtttaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page