(data stored in ACNUC7421 zone)

EMBL: CP000821.PE95

CP000821.PE95        Location/Qualifiers
FT   CDS_pept        105192..105854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0095"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="KEGG: slo:Shew_3715 GTP-binding protein,
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34708"
FT                   /db_xref="GOA:A8FPD5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPD5"
FT                   /protein_id="ABV34708.1"
FT                   /translation="MSESCIDFRKAKFLISAPDIAHLNEHLPGDAGVEIAFAGRSNAGK
FT                   SSALNLLTDQKSLARTSRTPGRTQLINIFELDENRRLVDLPGYGFAQVPLALKKKWQES
FT                   LGEYLQERQCLGGMVVLMDIRHPLKDLDMQMIAWALESEIPVLALLTKADKLKQSERMK
FT                   MVNEVRKHLGDFDDRVKVEPFSSLKGIGKAKVLGILNEWCHPQWLTDAIADAETEEE"
     gtgtctgaat cttgtattga ttttcgtaaa gcaaagtttt taatcagtgc tcctgatatt        60
     gctcatctga atgagcactt acctggggat gctggagtgg aaatcgcctt cgctggccgc       120
     tctaatgctg gtaagtcaag tgcattgaac ttactgactg accagaagag tctggccaga       180
     accagtagaa cgccgggaag aacccagcta attaacattt ttgaattaga tgagaatcgt       240
     cgcttggtgg atcttcccgg gtatggattt gctcaagttc ctcttgcctt gaagaaaaag       300
     tggcaggaat ctctgggaga atacctgcag gaacgccaat gtttgggggg aatggtggtg       360
     ctgatggaca tcaggcatcc gctgaaagat ctggatatgc agatgattgc ctgggcgcta       420
     gagagtgaaa taccggtgct tgccttgttg actaaggctg acaagttaaa gcagagcgag       480
     cggatgaaga tggtgaacga ggtgagaaag cacttaggtg attttgatga ccgggttaag       540
     gtcgagcctt tctcatcttt gaaaggaata ggtaaggcta aggtattggg tatcttgaac       600
     gaatggtgcc atccgcaatg gctgacagat gctattgccg atgcagaaac tgaagaagag       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page