(data stored in ACNUC7421 zone)

EMBL: CP000821.PE97

CP000821.PE97        Location/Qualifiers
FT   CDS_pept        109761..110414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0097"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: shn:Shewana3_4108 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34710"
FT                   /db_xref="GOA:A8FPD7"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD7"
FT                   /protein_id="ABV34710.1"
FT                   /translation="MKKIAVLLSGAGVFDGSEIHEAVLTMLALTKLGASYQCFAPDIEQ
FT                   MHVVNHLTGEVSAEESRNVLVESARIARGEIMATDRLDIEAFDALVIPGGFGAAKNLCN
FT                   FATNGSDCEISLEVSDFISEFADAKKPVGFICIAPIMIPLLYGEGVTGTIGNDVDTAQA
FT                   FNLMGGHHQEAVVQDIIVDEANKVVSTPAYMLAGNIAEANEGIEKLVKKVLEMV"
     atgaaaaaaa tagcagtctt attgagtggt gcaggtgtat tcgatggttc agagatccat        60
     gaggctgtgt taactatgct ggcactcact aaactcggtg ctagttatca atgttttgct       120
     cctgacattg agcagatgca tgtcgtcaat catctgaccg gagaagtttc tgctgaagag       180
     agtcgaaatg ttctggtgga gtcggcaagg attgcgaggg gcgagatcat ggctaccgat       240
     cgactcgata tagaagcatt cgatgcactg gttatccccg gtggttttgg tgcggcaaag       300
     aatctgtgca actttgcaac taatggcagt gactgtgaga tctctctcga ggtttccgat       360
     tttatctccg aatttgccga tgcgaaaaag cctgtcggct ttatctgtat cgccccaatc       420
     atgatcccac tgctttatgg agaaggagtg acggggacga ttggcaacga tgttgatacg       480
     gctcaggcat ttaacctgat gggaggccat catcaagaag ccgttgtaca agacattatc       540
     gtggacgaag ccaataaggt tgtgagtact cccgcgtata tgttggccgg aaatattgcc       600
     gaagctaatg aaggtatcga gaagctggta aagaaagtac tggagatggt ttag             654
//

If you have problems or comments...

PBIL Back to PBIL home page