(data stored in ACNUC7421 zone)

EMBL: CP000821.PE98

CP000821.PE98        Location/Qualifiers
FT   CDS_pept        complement(110846..111682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0098"
FT                   /product="rhomboid family protein"
FT                   /note="KEGG: slo:Shew_3712 rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34711"
FT                   /db_xref="GOA:A8FPD8"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD8"
FT                   /protein_id="ABV34711.1"
FT                   /translation="MIEIGRLPNERAAQALVDYLKGQNIDCKVIAAEQGVSLIVIHDQD
FT                   SVRAGIEFQRFIQNPYDEKYLQASWDNGDTNAKFDYGAPTLQLLTQFITGAGPLTLSIF
FT                   GVCILIFAGFNLGFANPIYEYLSFFNAVPGTELTDFWRVFTPSLLHFSALHIIFNLLWW
FT                   WYLGGKIENKIGISPLLTLLLVAGTLPNILQYFIGGPHFGGLSGVVYGVVGYTWIMGVK
FT                   RPEKGIGLPPALMGFLMLWLVFGFTDLFGLSIANGAHTGGLVVGLLQGLIDSKRRT"
     atgatagaga taggcagatt acccaatgag cgcgcagctc aggcactcgt cgattacctt        60
     aaaggtcaaa atatcgattg caaagtgatc gctgcagaac aaggtgtgag cttaatcgtt       120
     attcatgatc aagatagcgt acgggccgga attgagttcc agcgctttat tcaaaacccc       180
     tacgatgaga agtaccttca ggcttcctgg gataacggtg ataccaacgc aaaatttgac       240
     tatggcgccc cgacacttca gttgctgacc cagtttatta caggagccgg gccgctgaca       300
     ctatcgattt ttggcgtctg tattttgatt tttgccggat tcaacctcgg ctttgccaac       360
     ccgatttatg aatacctctc cttctttaat gccgtacccg gcaccgaact caccgacttt       420
     tggagagtat tcaccccatc gctgttacac ttttctgccc tgcacatcat tttcaatctg       480
     ctctggtggt ggtatttagg tgggaaaatt gagaataaaa tcggtatatc ccctctgctt       540
     actctgcttt tagtagcggg aaccctaccc aatattctgc aatattttat tggcgggcca       600
     catttcggtg gcctctccgg cgttgtctat ggggtcgtgg gttacacctg gatcatggga       660
     gtgaagaggc cagagaaagg aattggactc ccaccggcat taatggggtt tttaatgcta       720
     tggttagtct tcggattcac cgacctattc gggctctcca tcgccaatgg cgcacatacc       780
     ggtggtcttg tggtaggtct gttacaggga ttgattgata gcaaaagaag aacctag          837
//

If you have problems or comments...

PBIL Back to PBIL home page