(data stored in ACNUC7421 zone)

EMBL: CP000821.PE99

CP000821.PE99        Location/Qualifiers
FT   CDS_pept        complement(111747..112055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0099"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: slo:Shew_3711 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34712"
FT                   /db_xref="GOA:A8FPD9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD9"
FT                   /protein_id="ABV34712.1"
FT                   /translation="MSSFQHFSVNQLIQLSESNPDIQIADIRDAASFESGHVEGAINLS
FT                   NENLANFIAEADMDLPLIVICYHGISSQSAAQYLVEQGFDHVYSLDGGYQAWREAHT"
     atgtccagct tccagcattt tagtgtcaat caattgatcc aactctcaga gagtaaccca        60
     gatatccaga tagccgatat tcgcgatgca gccagcttcg agtcaggtca tgtagagggt       120
     gctatcaatc tttctaatga aaatttagca aatttcatag cagaagccga tatggatctc       180
     cccctcatcg tcatctgtta tcatgggatc agtagccaaa gcgccgcaca atacctggtc       240
     gaacagggtt ttgaccacgt atatagtctg gatggtggtt accaggcttg gcgagaagca       300
     cacacataa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page