(data stored in ACNUC5340 zone)

EMBL: CP000828.ACKA

CP000828.ACKA        Location/Qualifiers
FT   CDS_pept        426544..427740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="AM1_0445"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25501"
FT                   /db_xref="GOA:B0CB11"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CB11"
FT                   /protein_id="ABW25501.1"
FT                   /translation="MKILVLNAGSSSHKCCLYAIEGPLPDHPAPPLWEAQLDWHDPNHA
FT                   SLKVKTKRENLEEDLSDVSRADALSHLLTTLWHGPTQVIQMAQEINVVGHRVVHGGQDY
FT                   QSSVVVTSEVKTAIADLIPLAPNHNPANLEGIKLIEQLLGNVRQVAVFDTAFHSHLPEV
FT                   AAIYPGPYDWQQQGIRRYGFHGISHQYCTQRTAEILGRGVDRLIICHLGNGASLTAVKQ
FT                   GQSIDTSMGFTPLEGLMMGTRSGSIDPGILIHLMRQGYDADQLDHMLNKASGLKGISGV
FT                   SHDLREIEQAIAQDNAQAKLARDLYLHRLKACLGSMLMSLGGVDVLVFTGGIGEHSASV
FT                   RAETCEALAFLGLKLDPILNRKSPVDQDIAAVDSKVRVLVIKTQEDWAIAQSCYEQCC"
     atgaagattt tagttctcaa tgccggttct agcagccaca aatgttgcct ttacgcgatt        60
     gaagggcctc tccccgacca tccagcacct ccgctttggg aagctcagct ggattggcat       120
     gaccccaatc atgcctcgtt aaaagtcaaa accaaacgag aaaatctgga ggaagaccta       180
     tctgatgtat cacgcgccga cgcgctctct catcttttaa ccaccctatg gcatgggcct       240
     acccaagtca tccaaatggc acaggagatt aatgttgtcg gtcatcgtgt ggtgcatggg       300
     ggacaagact atcagtccag tgtggtggtg acatcggagg ttaaaactgc gatcgcagat       360
     ctgattcctt tagcccccaa ccataatcca gccaatttag aaggcattaa attgatcgaa       420
     caattgttag gaaatgttcg ccaagtagct gtcttcgata ctgcctttca cagtcatctt       480
     cccgaagttg cggccatcta tcccggtccc tatgattggc aacaacaagg cattcgtcgg       540
     tatgggtttc atggcattag tcatcaatat tgcacccagc gaacggcaga aattctgggc       600
     cgaggggtgg accgcctgat tatttgtcat ttgggaaatg gagcatctct gacagcggtt       660
     aaacaaggtc agagtatcga cacctcgatg ggcttcaccc ccttagaagg attgatgatg       720
     ggtacgcgtt cagggtcgat tgatccaggc attttaattc atctgatgcg gcaaggatat       780
     gatgccgatc agctagatca catgcttaat aaagcctctg gcttaaaggg gatctcaggg       840
     gtctcccatg atctgcggga gattgagcag gccattgccc aagacaatgc ccaagctaag       900
     ctagcgcgag acttatatct ccatcgattg aaagcttgtt tggggtccat gctgatgagc       960
     ttaggtggag ttgatgtctt agtgtttacg ggtggtatag gggagcattc tgcttcagtg      1020
     agagctgaga cctgtgaagc actggctttt ttgggcctta agcttgatcc gattctgaat      1080
     cgaaagtctc ctgtagatca ggatattgca gcagttgact ctaaggtgcg ggtattagtg      1140
     attaagaccc aggaagattg ggccattgct caatcttgtt atgaacagtg ttgttag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page