(data stored in ACNUC27125 zone)

EMBL: CP000828.CHLD

CP000828.CHLD        Location/Qualifiers
FT   CDS_pept        complement(513298..515346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlD"
FT                   /locus_tag="AM1_0533"
FT                   /product="magnesium protoporphyrin IX chelatase, D subunit"
FT                   /note="magnesium protoporphyrin IX chelatase complex,
FT                   subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25585"
FT                   /db_xref="GOA:B0CC43"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011776"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC43"
FT                   /protein_id="ABW25585.1"
FT                   /translation="MPVAELPQKITTFPLTAVVGQEAIKLALLLTAVDPTLGGVVIAGR
FT                   RGTAKSVMARAVHALLPPIEVVKGSICQGDPEDTSAWDDDLLASLEAGAIPIVDGQPQP
FT                   ETEIIPTPFVQVPLGVTEDRLLGSVDVSQSVKLGETVFQPGLLAEANRGVLYVDEINLL
FT                   DDQISNLLLTSLTEGRNQIEREGLSFQHPCSTIFIATYNPEEGPLREHLLDRIAISLSA
FT                   DQMLGLDLRVQAVEQATAYANSPQAFLAQYEDETDDLKTQILLAREWLKDVQIQHSQIV
FT                   YLVDEALRGGVQGHRAELFAVRVAKAHAALNGRSEVTAEDLRRAVELVIVPRATVIDAP
FT                   PPEQPQPPPPPPPQQDNSDQSDQDEEEEDDQNEEDPPEPEEPPSIPEEFVFDPDGVVLD
FT                   PQVLYFAQNASRQGKSGSRSIVFSEDRGRYVKPMLPKGGVKRIAVDATLRAAAPYQKAR
FT                   RLRHPNRRVIVEQSDVRTKRLARKAGALVVFVVDASGSMALNRMQSAKGAVMRLLTEAY
FT                   QNRDQVSLIPFRGERADVLLPPTRSIEAARRRLDTLPCGGGSPLAHGLTQAVRVGMNAL
FT                   SSGDIGQVVLVAITDGRGNIPLTTSLGEPPVDGEKPDIKAELLEIAGRIRALNLKLLVI
FT                   DTENKFISTGFAKELAQNAGGNYYHLPKATDQAIAAVTQDAISNLTG"
     atgccagttg ctgaacttcc ccaaaaaata accacctttc ccctcacagc tgtggtgggt        60
     caagaagcga ttaaattggc attattgctc acagcagttg atccaactct gggcggggtc       120
     gttattgcgg gtcggcgagg gaccgcgaaa tcagtcatgg cccgagcggt tcatgccctt       180
     ctccccccca tcgaagtggt caaaggctcc atctgccaag gcgatccaga ggatacttct       240
     gcttgggatg atgacctatt ggccagtcta gaggctggtg ccattccgat agtggatgga       300
     cagccccaac ccgaaaccga aattattccg accccatttg tccaggttcc tttaggagtg       360
     acagaagatc ggctgttagg ttctgtggat gttagccaat ccgtaaagct aggagaaacc       420
     gtatttcaac ccggactgtt ggcagaggcc aatcggggcg tcttatatgt ggatgagatt       480
     aatctactgg atgaccagat ttccaattta ttgctgacta gcctaacgga aggtcgaaat       540
     caaatcgaac gcgaggggct cagcttccaa catccttgct ctactatttt tattgccact       600
     tacaatccag aagaaggtcc tctacgggaa catctgctag atcgtatcgc tatttccctc       660
     tcagccgatc agatgttggg ccttgacctg cgagttcagg cagtggagca ggctactgcc       720
     tatgccaatt ctcctcaagc atttttagca cagtatgagg atgaaacaga tgatttaaaa       780
     actcagattt tgctggcgcg agaatggctc aaggatgttc agattcaaca ctctcagatt       840
     gtctatcttg tggatgaagc tctcagaggc ggagtgcaag gtcatcgagc cgaactattt       900
     gccgttcgtg tagccaaagc ccatgcggcc ctcaatggcc gttcagaagt cactgcagaa       960
     gatttacggc gtgctgttga attagtgatt gtccctcggg caacggtcat tgatgcccca      1020
     cccccagaac aaccacaacc cccacctccc cctccacctc aacaagataa ttccgatcag      1080
     tcagatcaag atgaagaaga agaggacgat caaaacgaag aagatccacc ggaaccagaa      1140
     gagcccccca gcattcccga agaatttgtg ttcgatcccg atggtgttgt cctcgatccc      1200
     caagtcttat actttgccca aaatgctagc cgacaaggga aatcaggtag tcggagtatt      1260
     gtcttttcgg aagatcgagg acgctatgtc aaacccatgt tgcccaaggg cggtgttaaa      1320
     cgaattgctg ttgacgccac gttgagagcg gcagctccct accaaaaggc acggcggttg      1380
     cgccacccga atcggcgagt cattgttgag cagtccgatg tccgcaccaa acggttggct      1440
     cgtaaagcag gagcattggt cgtgtttgta gtggatgcgt caggttctat ggcccttaac      1500
     cggatgcagt cggcgaaagg ggccgtgatg cgcttattaa cggaagccta tcaaaatcga      1560
     gatcaggttt ctttgatccc ttttagaggg gaacgggctg atgtactcct acccccgact      1620
     cggtctatcg aagccgctcg ccgccgtttg gatacgctgc cctgtggcgg tggatctcct      1680
     ttagcccacg gcttgaccca agcggttcgg gtggggatga atgccctctc atccggggat      1740
     attggtcagg tggtattggt cgcgattacg gatggtcgag gtaatattcc cttgacaaca      1800
     tccttgggtg aaccgccagt agatggggag aaacctgata ttaaggctga actgttagaa      1860
     attgcgggtc gcattcgagc cttgaatttg aaattgctgg tgattgatac cgagaacaag      1920
     tttatttcca ctggatttgc caaagagctg gcccaaaatg cagggggtaa ctactatcat      1980
     ttgccgaaag ccaccgatca agcgattgcc gcagtcaccc aagatgccat cagcaacttg      2040
     acgggttag                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page