(data stored in ACNUC27125 zone)

EMBL: CP000828.CORA

CP000828.CORA        Location/Qualifiers
FT   CDS_pept        84449..85570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="AM1_0079"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25167"
FT                   /db_xref="GOA:B0C555"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:B0C555"
FT                   /protein_id="ABW25167.1"
FT                   /translation="MTNPLSDPLQQGYVDYFYDQAGSSPGTLTIDEDASPTRIVVIDYN
FT                   PHQARRIIVEQPEESADYLTTETVSWIDVQGLGDEDILRRLGQTFDLHPLVLEDVVNVP
FT                   QRQKVEDFDDQLLIIARMVLPHPEGVGFVSEQVSFILHQQALLTIQEEPFHDSFGPVRK
FT                   RIRLQKGLMRKMGADFLTYALLDAIIDGFFPVLELYGERLETLEDEILDNPTRETLNQV
FT                   HSLKRELMNLRRLSWSQRDALSALLREDSPLISQEVKVYLRDCYDHSIQILDMVETYRD
FT                   FAASLMDVYLSSVSNKMNEVMKVLTVISTIFIPLTFISGLYGMNFNPQVSPFNMPELSW
FT                   YWGYPAVIATMLLISGSLSYLFWRRGWFSKVSP"
     atgaccaatc ctctatcaga ccctttgcag caaggttacg ttgattattt ttatgaccaa        60
     gcaggcagct ctcctggaac cctgacgatt gacgaagatg cttcacccac tcggattgtt       120
     gtcatcgatt acaacccaca tcaagcccgc cggatcatcg ttgaacaacc tgaagaaagt       180
     gcagattatc tgaccacaga aaccgtttct tggattgatg ttcagggact aggggatgag       240
     gatattctgc gccgattagg acaaactttc gatctgcatc ccttggtttt ggaagatgtg       300
     gtgaatgtac ctcaacgcca aaaagttgag gatttcgatg atcagctttt aattattgcc       360
     cgtatggttc ttcctcaccc tgaaggcgtc gggtttgtaa gtgaacaagt cagctttatc       420
     ttgcatcagc aagcattatt gacgattcaa gaagagcctt tccatgattc atttgggcca       480
     gttcgcaagc gaattcgatt gcagaaggga ttgatgcgaa aaatgggggc tgactttctc       540
     acctatgccc tcttagacgc cattattgat ggtttcttcc cggtgctaga actttacgga       600
     gagcggttag aaaccttaga agatgaaata ctcgacaatc ccacgcgaga gaccctcaac       660
     caagttcact ctctcaaacg tgagttgatg aatctacgac gactgagttg gtcacaacgg       720
     gatgctttat ctgccctcct acgggaagat agccccctaa tcagccaaga ggtaaaagtg       780
     tatctaaggg actgttacga ccattccatc cagatcttag acatggttga aacatatcga       840
     gatttcgcgg ccagtctgat ggatgtttat ctatcttctg tgagcaataa aatgaacgaa       900
     gtgatgaaag tcctcacggt catctcaaca atctttattc ccttaacctt tatttcaggg       960
     ctctatggca tgaactttaa ccctcaagtt tcccctttta acatgcctga gttgagctgg      1020
     tactggggat atcctgcggt catcgctacc atgttgctga tttcgggaag tctaagctat      1080
     ttattttggc gtcgcggttg gtttagcaag gtatcacctt ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page