(data stored in ACNUC8465 zone)

EMBL: CP000828.CYSC

CP000828.CYSC        Location/Qualifiers
FT   CDS_pept        complement(380125..380742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="AM1_0406"
FT                   /product="adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25463"
FT                   /db_xref="GOA:B0CAX3"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CAX3"
FT                   /protein_id="ABW25463.1"
FT                   /translation="MIMKSSNVVWHKSTVTRQNRQEQNGHLSTILWFTGLSGAGKSTLA
FT                   HTVEDALSKMNCRTFVIDGDNIRHGLCADLGFSSEDRVENIRRIGEVAKLFTEAGIIVL
FT                   SAFISPFRADRDRVRELVPEGDFIEIYCQASLEVCEERDVKGLYKKARSGEIPNFTGIS
FT                   SPYEPPEEPEIIVKTGEDSLEVCAQQVIEFLQERGIVQPTSA"
     atgattatga aatcttctaa tgttgtctgg cataagtcta ccgtcacacg ccagaaccga        60
     caggagcaaa atggccacct gagtactatc ctttggttta cgggactatc tggtgcgggt       120
     aaatcgacgc tggctcacac cgttgaagat gccctatcta agatgaactg ccgaactttt       180
     gttatcgatg gagataatat tcgccacggc ttgtgtgcag atcttggttt ttcgagtgaa       240
     gatcgagttg aaaatattcg ccgaattggt gaagtcgcta aactatttac ggaagcaggc       300
     atcattgttt tgtcggcatt tatttctcca tttcgggctg atcgagatcg tgttcgtgaa       360
     ttggttccag aaggtgactt tattgaaata tattgccaag ctagtctaga agtttgtgaa       420
     gagcgagatg taaaagggtt atataagaag gctagatcgg gagaaatccc taactttaca       480
     ggtatttctt ctccctatga gccacctgaa gaaccagaga ttatcgtgaa gacgggggaa       540
     gattccctag aggtttgtgc acagcaggtg attgaatttt tacaggagcg ggggattgtt       600
     caacccacct ctgcttag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page