(data stored in ACNUC27125 zone)

EMBL: CP000828.DINF

CP000828.DINF        Location/Qualifiers
FT   CDS_pept        complement(330470..331819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="AM1_0362"
FT                   /product="DNA-damage-inducible protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25421"
FT                   /db_xref="GOA:B0C9Y1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9Y1"
FT                   /protein_id="ABW25421.1"
FT                   /translation="MGLSIPAHYRSFLPRFYQLAVVSALSNMMVPLAGLFDTAFLGHLD
FT                   DIRHLAGVILGSVLFDYLYRILKFFRNSTNAITAQAEGEKNHQEVLLAGLRSSMVAIAV
FT                   AILILILQYPLQRLGFAVLSGSPEIEAAGLDYFNARIWGAPAVLLNFVLIGWFLGREMN
FT                   RIVLIISLVGNGSNVLLDYLMINRWGWDSMGAGLATALSQYLALGVALVAVVSSIEWAR
FT                   VPAALKQVWDVAAFKSTLLLKGNILIRFVALISAYAIFTNLSTTLGTTILAENGLMLQI
FT                   AFLSQFTVNGVGLTTQTLVGNFKGKGESELMMPILYTSIVHGLLISLPFAVLSVLFPVT
FT                   VFGLLTSHTEVSYSIHTYVIWLVPLLSLTAVAFVLEGYFIGLKEGAILRNSALTALGIG
FT                   YAPIAIAGWYYQSNHLLWTSLTVYMATLTLSLSLQILKNQQNFQSSLSQT"
     atgggcttat caatcccggc tcactataga agttttctcc ctcgctttta tcagctcgcg        60
     gttgtgagtg ccctatcgaa tatgatggtg cccctggcgg gtttgtttga tacggccttc       120
     ctgggacatc tcgacgatat tcgccaccta gctggggtga tcttgggtag cgttctcttc       180
     gattacctct accgcatcct caagttcttt agaaatagta ccaacgctat tacagcccaa       240
     gcggaaggtg agaagaacca tcaagaggtt ctgttggctg gattgcgcag cagcatggtt       300
     gcgatcgcag tagccatcct catccttatc ctgcaatatc ccttgcaacg tctggggttt       360
     gcggtcttat ccggttctcc agaaattgaa gccgcagggc tcgattactt caatgcccgc       420
     atctggggag cccccgccgt attgcttaac tttgtgctga ttggctggtt cttggggcgg       480
     gaaatgaacc ggattgtcct aattatttca ctggttggta acggttccaa tgtcctcctg       540
     gactatttga tgattaaccg ctggggttgg gacagcatgg gggcaggact cgcaacagcc       600
     cttagccaat atttagccct gggagtagct ttagtcgcag tggtctccag catcgaatgg       660
     gctcgggtgc ctgctgcctt aaaacaggtc tgggatgtcg ctgccttcaa atccaccctg       720
     ctgctcaagg ggaatatcct aattcgcttt gtggccttaa tttcggccta tgccattttc       780
     accaacttga gcaccacctt gggcacaact atcctggcgg aaaatggttt gatgctccaa       840
     atcgcctttt taagccagtt cacggtgaat ggtgttgggc tcacgactca gaccctcgtt       900
     ggcaacttta agggcaaagg ggagtcagaa ttgatgatgc caattctcta tacctcgatt       960
     gttcatggac tgctaatctc cctgcctttt gcagttcttt ccgttctgtt tccagtgacg      1020
     gtgtttggac tattgaccag ccatacagaa gtcagctatt ccatccatac ctatgtgatc      1080
     tggttggtac cgctactgag tttaacagcg gtagccttcg tattagaagg atattttatt      1140
     ggtctcaaag agggcgctat tcttcgaaat tctgcgttga cggcgctggg aattggctat      1200
     gcaccgattg cgatcgcggg ttggtattac caaagtaatc atctgctgtg gacctccctc      1260
     acggtttaca tggctaccct gacgctttct ctttccttac agattttgaa aaatcaacag      1320
     aactttcaat cttctctaag ccaaacctaa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page