(data stored in ACNUC5340 zone)

EMBL: CP000828.DNAK

CP000828.DNAK        Location/Qualifiers
FT   CDS_pept        396547..398535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="AM1_0422"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25479"
FT                   /db_xref="GOA:B0CAY9"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY9"
FT                   /protein_id="ABW25479.1"
FT                   /translation="MGKVIGIDLGTTNSCVAVLEGGKPVVIPNTEGGRTTPSIVGFAKS
FT                   GDRLVGQLAKRQAVTNAENTIFSIKRFIGRRWQETETERSRVAYTSVPGKDETVDVQIR
FT                   GKNYTPQEISAMVLQKLKQDAEAYLGEAVSQAVITVPAYFSDAQRQATKDAGTIAGLEV
FT                   LRIINEPTAASLSYGLEKQEEDHKILVFDLGGGTFDVSILQLGDGVFEVKATAGNNHLG
FT                   GDDFDESILKWMLESFRQTESIDLSKDKMALQRLREAAEKAKIELSSTITTSINLPFST
FT                   ADETGPKHLEMDLTRAKFEELAAELVTGTMEPVERALKDSDLQAEDIDRIILVGGSTRI
FT                   PAVQEAVKQYFGGQSPDRSVNPDESIALGAAIQAGVLGGEVKDLLLLDVSPLSMGIETL
FT                   GGVFTKIIDRNTTLPTSRSQSFSTATDGQTCVEIQVYQGERAMVKDNKCLGRFELTGIP
FT                   PAPRGVPQIEVTFDIDANGILNVSAQDKGTGREQSIRISNTGGLSSLEVERMRQEAQIY
FT                   ADQDRQLKEVAHQKNQIDSMLYSCSATLKDNASTVSPELKQRAEQAAAELKVLADQPDV
FT                   TAEMLKLRIDTLQQVLLDIGAEVYQQSATNSPSANDVYNPSDVYNSQPSTVVTPDLVSE
FT                   PSAPLDDDSTIVGDFDDTVITDYEAVD"
     atgggtaagg tcattggtat tgatctagga acaacgaata gctgtgttgc tgttcttgaa        60
     gggggaaaac cggtcgttat ccccaatact gaagggggca gaacgacccc tagtattgtc       120
     ggttttgcta aatctgggga ccgcctagtt ggccaacttg ccaaacgaca agcagtcacc       180
     aacgctgaaa acaccatttt cagtattaag cgtttcattg gccgtagatg gcaggaaaca       240
     gaaacggaaa gatctcgtgt cgcttatacc tctgtacctg gcaaagatga aaccgttgat       300
     gttcaaattc gagggaaaaa ctatacccct caggaaattt cagcaatggt tttgcaaaag       360
     ctgaaacaag atgctgaagc ctacttagga gaggcagtgt ctcaagcagt tatcacagtt       420
     cctgcttatt tcagtgatgc ccagcgccaa gccacaaagg atgcaggaac catcgctgga       480
     ttagaagttc tgcgaatcat caatgaacct accgcagcct ctctatctta tggtttggaa       540
     aagcaagagg aagaccataa gattttagtc tttgacctag gagggggtac ctttgatgtt       600
     tccatccttc aactcggaga tggcgtcttt gaggtaaaag ccactgctgg caacaatcac       660
     ctcggtgggg atgacttcga tgaatccatt ttgaagtgga tgttagaaag ttttcgccaa       720
     actgaatcga ttgatctatc caaagacaag atggccctgc agcgattacg ggaagcagca       780
     gaaaaagcca agatcgagct atctagtacc attacaacct ccattaactt gccattcagc       840
     acggctgatg aaacaggtcc caaacatttg gagatggatt taacccgagc caaatttgaa       900
     gagttagctg ctgaacttgt aacaggaacg atggaacctg ttgaaagggc tctcaaggat       960
     tcagacttac aagctgagga cattgatcgc atcattttgg tgggaggctc cacccggatt      1020
     cctgcagtcc aagaagccgt caaacaatac tttggcggtc aaagtccgga tcgctcggtt      1080
     aatcctgacg aatcgattgc cctaggtgct gccattcaag ctggtgtgct gggtggggaa      1140
     gttaaggatc tcttgctcct agacgtgtcc cccctatcga tgggtattga aactttggga      1200
     ggggtattta ccaaaatcat tgaccgcaat acaaccctgc ccaccagccg ttcacagagc      1260
     ttttctaccg caacagatgg gcaaacctgt gtagaaatcc aggtttacca gggtgagcgg      1320
     gccatggtga aagataacaa gtgtctcggt cgttttgaat taaccggcat tcctccggca      1380
     ccgcggggtg taccgcaaat tgaagtcacc tttgatatcg atgctaatgg cattctcaat      1440
     gtttctgccc aagataaagg cactggacgg gaacaaagta tccggatctc taataccgga      1500
     ggcttaagta gcttagaagt tgagcgaatg cgccaggaag cccaaatcta tgcagatcaa      1560
     gatcggcagt tgaaagaagt tgcccatcag aaaaatcaga ttgacagcat gctgtatagc      1620
     tgcagtgcca ctttgaagga taatgcgagc accgtttctc cagaactcaa gcaacgggcc      1680
     gaacaagcag cggctgaact taaagtttta gccgaccagc ctgatgtcac tgcagaaatg      1740
     ttgaagcttc gcatagatac cctccagcag gtactcttag atattggggc tgaagtttat      1800
     cagcagtcgg caacaaactc accatcggcg aatgatgttt ataatccgag tgacgtttat      1860
     aatagtcaac ctagcactgt agtaacgcct gatctagttt cagaaccttc agcaccgttg      1920
     gatgacgact ccaccatagt tggagatttt gatgatacgg ttatcactga ctatgaagcc      1980
     gtagattag                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page