(data stored in ACNUC27125 zone)

EMBL: CP000828.FABZ

CP000828.FABZ        Location/Qualifiers
FT   CDS_pept        complement(572352..572822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="AM1_0584"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25635"
FT                   /db_xref="GOA:B0CD44"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CD44"
FT                   /protein_id="ABW25635.1"
FT                   /translation="MSNPSDGSTDPKTTFMIEEIQELLPHRYPFLLVDRIIDYKESERA
FT                   VGIKNVTMNEEFFQGHFPGRPLMPGVLIVEAMAQVGGIVLAQLPDIPSGKLFVFTGIDK
FT                   VRIRRSVVPGDQLVITAEFLSLKRKRFAMMSTKAEVDGKLACSGELMFAMVD"
     atgtcaaatc cctctgatgg ctctaccgat cccaaaacca cctttatgat tgaggagatt        60
     caagagctgc tgccccatcg atatcccttt cttctggtag atcgcattat tgactacaaa       120
     gagtctgagc gggcagtggg catcaagaac gtgacgatga atgaagagtt ctttcagggc       180
     catttccccg gtcgaccgct gatgccaggg gtattgattg tggaagccat ggctcaagtg       240
     ggcggaattg tcctggctca acttcccgat atcccttctg gcaagttatt tgtcttcaca       300
     gggattgata aagtccgaat tcgccgctcc gttgtcccag gagaccagct cgtgattacc       360
     gccgaattcc tgtctttgaa gcgcaagcgg tttgccatga tgtccacgaa ggctgaagtg       420
     gacggcaaac tggcctgttc aggagagctg atgtttgcca tggtggatta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page