(data stored in ACNUC27125 zone)

EMBL: CP000828.FEOB

CP000828.FEOB        Location/Qualifiers
FT   CDS_pept        complement(453944..456304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="AM1_0473"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25529"
FT                   /db_xref="GOA:B0CBY7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY7"
FT                   /protein_id="ABW25529.1"
FT                   /translation="MSTPTIALIGNPNCGKTTLFNDLTGTNQRTGNWPGVTVDQKTGHY
FT                   HYNGTKTTVVDLPGVYSLDGEDDSTGLDEVIARDYLLSTEADLILNIVDASNLERNLYL
FT                   TTQIMEMGLPMVVALNMMDIAQDHDLDIDAQVLSQRIGCPVSTMSAFLGEGIHEIKDII
FT                   NSYVDDPKNHPTFVTYPAVIEDAIHQLEPIVQQQGHNSKIAPRWTALKLLEYENRVAPE
FT                   LQGQQLEQIIAKHRRQVHQLLHEDIDILVADTRYGYIRSLMQAAVQQTHQVSHSKSDQI
FT                   DQVVLNRWIGIPLFLVVMYLMFFIAINIGGAFIDFFDIAVGTLFVDAPQTWLESIGTPG
FT                   WLTGIIIAAGSGIQTVATFIPQIGLLFLILALLEDSGYMARAAFVMDKLMRFVGLPGKS
FT                   FIPMLVGFGCNVPAIMATRTLENRRDRLMTIMMNPFMSCGARLPVYALFAAAFFPRNGQ
FT                   NLVFGLYLIGIAAAVFTGFVMKNTIMQGEASPLVMELPPYHIPKIKGVFLRAGDRLKTF
FT                   LLKAGKMIVLMVMVLAFLNSVGTDGSFGQQDSQNSVLSASSRTITPMFAPMGVQAENWP
FT                   ATVGIFTGVFAKEAMVGSLDSLYGQLAEEAAPSEADPPFNLGENLQAAFVSIPTNIVSL
FT                   GNQLLDPLGLNVGDVQDQSAVAEEQELSTSTFGQMAQRFGTSTAAFAYLLFVLMYFPCV
FT                   AATGAVYRETNLGWTALVAAWTTGLAYWVATMFYQMATFAQHPGFSTVWIGGGVVVMVA
FT                   VIGLLKSFGTQRNTISISPIKSTNRPKVTAGRR"
     atgtcaacac cgaccattgc cttaattggc aacccaaact gtggtaaaac cactcttttt        60
     aacgatttaa ctggaacgaa ccagcgaacg ggtaattggc caggggtgac cgttgatcag       120
     aaaacgggac actatcacta caatggcacc aaaacgacgg tggtggattt gcctggggtg       180
     tattccctag atggcgaaga tgacagtacg ggtttagacg aagtgattgc ccgcgactat       240
     ctactgtcca ccgaggccga tttaattttg aatattgtcg atgcctctaa cttggagcga       300
     aatctctacc tcaccaccca aatcatggaa atgggactgc ccatggtggt tgccctaaat       360
     atgatggaca ttgctcagga tcacgacttg gacattgatg cgcaggtgct atcccaacgt       420
     ataggctgcc ccgtgagtac catgagtgcg tttctaggag agggcatcca cgaaatcaaa       480
     gatattatta atagctatgt tgatgatccg aaaaatcatc ctacctttgt cacttaccct       540
     gcagtgattg aggatgccat ccatcagcta gagccgatcg tccaacaaca ggggcataat       600
     tctaaaattg cgcctcgctg gaccgctttg aagttgctgg aatatgaaaa tcgggtggcc       660
     ccagagttgc agggacagca gcttgagcaa atcattgcca aacatcgtcg ccaagttcac       720
     cagttgttgc atgaggatat cgatattttg gtggcggata cccgctatgg ctatatccgc       780
     agtctgatgc aagcggcggt tcaacaaacc catcaggtca gtcactccaa atcggatcag       840
     attgatcagg tcgtcctcaa tcgctggatt ggcattcccc tatttttggt ggtgatgtat       900
     ttgatgtttt tcattgccat taatatcggt ggggccttta tcgacttttt cgatattgcc       960
     gtggggacac tatttgtcga tgcgcctcaa acttggcttg agtccattgg cacaccgggc      1020
     tggctcacgg gtatcatcat cgcagcgggg agtggcatcc aaaccgtcgc gacgtttatc      1080
     ccccaaattg gtctgctgtt tctgattctg gcgttgctag aagattcagg ctatatggcc      1140
     agagccgcgt ttgtgatgga taagctgatg cggtttgtcg gcttgccggg taaatcgttt      1200
     attcccatgt tggtgggatt tggctgtaat gtaccggcaa ttatggcgac tcgaactttg      1260
     gaaaaccgac gcgatcgcct gatgacaatc atgatgaatc cctttatgtc ctgtggggcc      1320
     aggttacctg tgtatgcact gtttgcagcg gccttttttc cccgtaatgg tcagaatttg      1380
     gtatttggcc tatacctaat tgggatcgct gccgccgtct ttaccgggtt tgtaatgaaa      1440
     aacacgatta tgcagggcga agcatcccca ctggtaatgg aattaccccc atatcacatc      1500
     cctaaaatta aaggggtttt tctgcgggct ggggatcgcc tcaaaacctt cttgctgaaa      1560
     gcgggcaaga tgattgtgct gatggtgatg gttctggcct tcttaaattc tgttggcact      1620
     gatggctcct ttggtcagca ggatagccaa aactcagtgt tgtcagccag cagtcgaacc      1680
     attacgccta tgtttgcccc tatgggcgtt caagccgaga attggccagc gacggtgggt      1740
     atttttacag gtgtctttgc taaggaggcc atggtgggat cgttggattc gctctacggt      1800
     caactggccg aagaagcagc acccagcgag gcagatcctc cctttaattt gggtgagaat      1860
     cttcaggctg cctttgttag catcccgacc aatatagtca gtttggggaa tcaattgctc      1920
     gatccgctgg gattaaatgt tggtgatgtc caagatcaga gtgcagtggc tgaggaacaa      1980
     gaactctcca caagtacctt tggccaaatg gctcagcggt ttggtacttc aacggcggct      2040
     tttgcctatc tcttgttcgt gctgatgtat tttccctgtg tcgcagcaac tggagcggtt      2100
     taccgagaaa ccaatttagg ctggacggcc ttggtcgcgg cttggacgac tggcttggcc      2160
     tattgggtgg cgaccatgtt ttaccaaatg gctacattcg cccagcatcc tgggttctct      2220
     actgtttgga ttggaggcgg agtagtggtg atggttgcag tgattggtct tttgaaaagc      2280
     ttcggtactc agcgaaatac catctccatt agtccaatca aaagcactaa tagaccaaaa      2340
     gtaaccgcag gtaggcgtta a                                                2361
//

If you have problems or comments...

PBIL Back to PBIL home page