(data stored in ACNUC27125 zone)

EMBL: CP000828.HLI

CP000828.HLI         Location/Qualifiers
FT   CDS_pept        complement(189785..189949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hli"
FT                   /locus_tag="AM1_0187"
FT                   /product="high light inducible protein"
FT                   /note="CAB/ELIP/HLIP superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25273"
FT                   /db_xref="GOA:B0C7L3"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7L3"
FT                   /protein_id="ABW25273.1"
FT                   /translation="MIEPSRVPNQISPKFGFNEFAERFGGRAAMIAFIAALVFEAVTGQ
FT                   GIFSYLGLA"
     atgattgaac ccagccgcgt tccaaatcaa atttctccca agtttggatt caatgaattt        60
     gcagaacggt ttggcggtcg cgctgccatg attgctttta ttgccgctct tgtttttgaa       120
     gcggtaaccg gtcagggcat tttttcttat ctgggactag cctag                       165
//

If you have problems or comments...

PBIL Back to PBIL home page