(data stored in ACNUC27125 zone)

EMBL: CP000828.LYSC

CP000828.LYSC        Location/Qualifiers
FT   CDS_pept        747149..748921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="AM1_0770"
FT                   /product="asparate kinase, monofunctional class"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25814"
FT                   /db_xref="GOA:B0CFC7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFC7"
FT                   /protein_id="ABW25814.1"
FT                   /translation="MGLIVQKFGGTSVGSVERIKAVAQRVKQTVAQGNSVVVVVSAMGK
FT                   STDTLVQLAQEVSSNPCRREMDMLLSTGEQVSISLLSMALQALGQPAISLTGAQVGIVT
FT                   EPEHTRARILHIATERLERHLEEGKVVVVAGFQGTSNTSDLEVTTLGRGGSDTSAVALA
FT                   AALHAEKCEIYTDVAGVLTTDPRLVEKAQLMTEITCEEMLELASLGANVLHPRAVEIAR
FT                   NYGVQMAVRSSWTDEPGTQIISTGTQPKTLTDLELGRPVDAVHFDLNQAKVALLHVADR
FT                   PGVAAGLFGELANQGLDVDLIIQSIHDGNSNDIAFTVAQDCCVQAEAVANAFNSTVPSG
FT                   STSEVLVEPNVAKVSIVGAGIIGRPQIAAQMFQTLSDLGINLQMISTSEVNVSCTITAA
FT                   DCERATKALCDVFEVTSSSIDSGISLPDYPIPPVRGVALDLEQAQLAIRNVPDRPGMAA
FT                   HIFQVLAKRNISVDMIIQSQRSRQVEGQITRDIAFTVAEGDLEVAKGLLQDLSRNLGCG
FT                   EVASDSAIAKVSIVGIGMLGQPGVAAQMFMALAQQKINIQMIATSEIRVSCVVAQGDGS
FT                   TALQAIHQAFGLEG"
     atgggcctaa ttgttcagaa gtttggtggc acgtccgttg gttcggtaga gcggatcaaa        60
     gcggttgctc aacgggtaaa gcagaccgtt gcccagggca actcggtggt ggtggtggta       120
     tcggccatgg gcaagagcac tgataccctg gtccagctcg cccaagaagt atcctccaat       180
     ccctgtcggc gggagatgga catgttgcta tcgacgggag aacaggtctc gatttccctg       240
     ctgagtatgg ccctccaagc actgggacag cccgctattt ccttgaccgg ggctcaggtg       300
     ggcattgtca cagagcctga acatacccgc gctcgcatcc tccacattgc cacggaacga       360
     ttagagcgcc atctagaaga aggaaaagtg gttgtagtcg ctggatttca gggcacttct       420
     aacacttccg atttggaagt gacaacatta gggcgagggg gatcggatac ctctgcggtg       480
     gcattagcag cggcccttca tgcagaaaaa tgtgagatct atacggatgt agctggggtc       540
     ctcaccacgg accctcggct ggtggagaag gcccaactga tgacagagat tacctgcgag       600
     gaaatgttgg agcttgcaag tctaggagcc aacgtacttc atcctcgggc cgtagaaatt       660
     gctcgcaatt atggggtgca gatggccgtt cgctccagct ggaccgatga accgggcacc       720
     caaatcattt caaccgggac ccagcctaag accttaacgg acctggagtt gggtcggcct       780
     gtggatgcgg tgcattttga tctgaaccag gccaaggtgg cgttgctcca tgtggcggat       840
     cgtcccggtg tcgcagctgg gttgtttggc gagttagcca atcagggtct ggatgtggac       900
     ctgatcattc aatccatcca tgatggtaat tcaaatgata ttgccttcac cgttgcccag       960
     gactgttgtg ttcaagcgga ggctgtggca aatgccttta attctacggt gccttctgga      1020
     agtacctcgg aagtgctagt cgaaccgaat gttgccaagg tcagtattgt cggggcaggg      1080
     attattggtc gcccacaaat tgcggcccag atgtttcaga ccctgagtga tttaggcatt      1140
     aatttgcaga tgatttccac ttctgaagtg aatgtcagct gcaccattac cgcagcagat      1200
     tgtgaacggg caaccaaggc tctgtgcgat gtgtttgaag tgacgagctc ttcgattgat      1260
     agtggaatct ctttgccgga ttatccgatt cctccagtgc gaggggtggc cttggactta      1320
     gagcaggctc agttagccat tcggaatgtc ccggatcgtc cgggcatggc ggctcatatt      1380
     ttccaggtct tggccaagcg aaatatcagt gttgatatga ttattcagtc ccagcgctcc      1440
     cgccaggtgg aagggcagat tactcgagat atcgccttta ccgtagctga gggggattta      1500
     gaggtggcta agggactctt acaggatttg tcccgcaatc taggatgtgg ggaagtggca      1560
     tccgattctg cgatcgcaaa agtcagcatt gttggtatcg gtatgttggg gcagccgggg      1620
     gtagcagctc agatgtttat ggccttagcc cagcagaaaa tcaacattca aatgatcgcc      1680
     acctcggaaa ttcgagtcag ttgcgtcgtg gcccaaggag atgggagtac tgcgttacaa      1740
     gccattcatc aggcatttgg cctagagggc tag                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page