(data stored in ACNUC8465 zone)

EMBL: CP000828.MODA

CP000828.MODA        Location/Qualifiers
FT   CDS_pept        complement(752170..752946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="AM1_0773"
FT                   /product="molybdate ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25817"
FT                   /db_xref="GOA:B0CFD0"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFD0"
FT                   /protein_id="ABW25817.1"
FT                   /translation="MKLPAPQLIISLGALILGGCQLLPQTRQLRISAASSLRTVLQTLE
FT                   PEFEKAYPQVDLTFNFAASGVLQRQIEQGAPVDVFFSAAPQPINRLLEQQLITQDSHRS
FT                   VVTNQLALIVPEQSQMSLTGFQQLTSPQVKKIMVGERASVPAGQYAQEVFAKLDLSQQL
FT                   QAKLIFANNVRGVLAAVASANVDAGIVYATDVRQSDRVKQVALAPAQSHSPIVYPIAIV
FT                   AASSQPQTAQSFIDFLSTPEAQDRFTQAGFGLVSKD"
     gtgaaacttc ccgccccaca actgataatc agcctagggg cgttaatctt ggggggatgt        60
     caacttctcc ctcaaacccg acagctcagg atatctgctg cttccagtct gcgaaccgtt       120
     ttacaaaccc tagaacccga atttgagaag gcatatcccc aggtggatct cacctttaat       180
     tttgcggcct cgggggtctt acagcgccaa atagagcaag gggcacctgt ggatgtgttc       240
     ttttccgctg cgcctcaacc catcaatcgt ctgctggaac agcagctcat tacccaagac       300
     tcccatcggt ctgtggttac gaaccaactt gctctaattg tgcctgagca gtctcagatg       360
     tctctgactg ggtttcagca gttaacgtca ccccaagtta aaaaaattat ggtgggggaa       420
     cgagcgagtg tgccagcggg acaatatgcc caagaagtgt ttgcgaaact cgatttatct       480
     caacagcttc aggctaagct gatttttgct aataacgtgc gtggggttct ggcggcggtg       540
     gccagtgcca atgtagatgc cggtattgtc tatgccacgg atgtgcgcca gtccgaccgg       600
     gtgaagcagg tggcccttgc cccagcccaa agccattctc ctattgtcta tccgattgcg       660
     attgtggctg caagctccca gccccagacg gctcaatctt ttatcgattt tttatccacg       720
     cctgaagcgc aagatcgctt cacccaggct ggatttggtt tagtgtcgaa ggattga          777
//

If you have problems or comments...

PBIL Back to PBIL home page