(data stored in ACNUC27125 zone)

EMBL: CP000828.NBLB

CP000828.NBLB        Location/Qualifiers
FT   CDS_pept        44143..44808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nblB"
FT                   /locus_tag="AM1_0043"
FT                   /product="PBS lyase HEAT repeat NblB-like protein"
FT                   /note="PBS lyase HEAT-like repeat (COG1413) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25131"
FT                   /db_xref="GOA:B0C519"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B0C519"
FT                   /protein_id="ABW25131.1"
FT                   /translation="MPHPRLQELTLKLKSENASDRLLALVALRSLPSAETFPLIKPMLF
FT                   DDYLPVRSMAIRSLIHHPSAESVSLLVQLLDDPNYEIRAGAAGALGHVGDHDIVQALSR
FT                   VFLEDTEWLVCFSAAVSLGNLKDPGAYAVLLHALDHPETIVQQAAIAALGEIKAFDALE
FT                   SLLPFVQAEDWMIRKSLATTLGNLPGPKSISALKYLAKDDNPQVAAAATVALELIHEP"
     atgccccatc cccgacttca agaattgacc ttgaagttaa aaagtgaaaa cgctagcgat        60
     cgtctgttag cattggtggc cttaagaagt ctccccagcg ctgaaacatt cccgttgatc       120
     aaaccgatgc tgtttgacga ctatttaccc gttcgctcca tggccatccg ttcgttgatc       180
     catcaccctt cagccgaatc ggtatcactt ctggtacagc tattagacga tccaaactat       240
     gaaatccggg caggtgctgc tggagcccta ggacatgtcg gtgatcatga tattgttcaa       300
     gccctgtcta gagttttcct tgaagatacc gagtggctgg tgtgttttag tgctgccgtt       360
     tcgttgggaa acctcaagga tccaggggcc tacgccgtgc tcctccatgc cctagaccat       420
     ccggaaacga ttgtgcagca agctgcgatc gcagccctgg gagaaattaa agccttcgat       480
     gccctagaat ccctcctccc ctttgttcaa gctgaagatt ggatgatccg taagagtctc       540
     gctactacct tgggtaacct tcccggtcca aaaagcattt cagcgctgaa atacttagcc       600
     aaagacgata atcctcaggt tgcagccgca gccactgtcg ccttagagct gatacatgag       660
     ccgtaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page