(data stored in ACNUC8465 zone)

EMBL: CP000828.NRDG

CP000828.NRDG        Location/Qualifiers
FT   CDS_pept        436139..436762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="AM1_0457"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="class III (anaerobic) ribonucleotide reductase:
FT                   activating protein for anaerobic ribonucleotide
FT                   triphosphate reductase (NrdG)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25513"
FT                   /db_xref="GOA:B0CB23"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB23"
FT                   /protein_id="ABW25513.1"
FT                   /translation="MNTQNNLPPKALLDIPPGYLNIMGYVDESEVNGPGCRAVIWMQGC
FT                   HRACPGCFNPDSWSFEINQLIDVKSLVQNVLSNPRHEGVTFSGGEPFWQAPALIELAHQ
FT                   VKAAGLNVMSFTGFTLAQLQADSAPVGAQNLLDQLDILIDGPYIEVLKIHSPDSPVASS
FT                   NQQVHIFNPSLQDKITWASDQLEIHIQPDGSRTFTGYHGQLLGS"
     atgaatactc agaataacct gccaccaaaa gctctcttgg atattcctcc cggatatctg        60
     aacatcatgg gatatgttga cgaatctgaa gtgaatggtc ccggttgtcg agctgtcatc       120
     tggatgcaag ggtgccatcg ggcctgccct ggttgtttca accctgactc atggtcgttt       180
     gaaattaacc agttaatcga cgtaaaatct ttggtccaga atgttctcag caatccgcgc       240
     catgaaggcg tcactttttc tggtggagag cccttctggc aagctcctgc cctcattgaa       300
     ctcgctcatc aagtcaaggc tgctggatta aatgtgatgt catttacggg atttacgttg       360
     gctcagttac aggcagactc ggcacccgtc ggtgcccaaa atctgctgga ccagttggat       420
     atcctcattg atggcccata tatcgaagtt ctcaaaattc actccccaga ttcgcctgtt       480
     gcatccagca atcagcaggt tcatatcttc aatccatctc tccaagacaa aatcacgtgg       540
     gcgagtgacc agctggagat tcatattcaa ccagacggaa gccgaacctt tacggggtat       600
     cacggccagt tgctcgggtc ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page