(data stored in ACNUC27125 zone)

EMBL: CP000828.PDHB

CP000828.PDHB        Location/Qualifiers
FT   CDS_pept        complement(677247..678230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="AM1_0696"
FT                   /product="pyruvate dehydrogenase E1 component beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25742"
FT                   /db_xref="GOA:B0CEA8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEA8"
FT                   /protein_id="ABW25742.1"
FT                   /translation="MAEVLLFNALRDAIDEEMANDNTVMVMGEDVGHYGGSYKVTKGLY
FT                   DKYGELRVLDTPIAENSFTGMAVGAAMTGLKPIIEGMNMGFLLLAFNQIANNAGMLRYT
FT                   SGGNFKIPMVIRGPGGVGRQLGAEHSQRLEAYFQAVPGLKIVACSTPYNAKGLLKAAIR
FT                   DPNPVLFFEHVLLYNLKEELPDQEYVLPLDKAEVVRSGKDVTILTYSRMRHHVVQAAKT
FT                   LTEQGYDPEIIDLISLKPLDFDTIGASIRKTHRVIVVEECMRTGGVGAEIIASINDRFF
FT                   DELDAPVVRLSSQDIPTPYNGMLESLTIVQPPQIVEAVQQITALQV"
     atggctgaag tactgttatt taacgccctc cgtgacgcca ttgacgaaga aatggctaat        60
     gacaacaccg tcatggtgat gggagaagac gtgggccact atggtggctc ctacaaagtc       120
     acaaaaggct tgtatgacaa gtacggagag ctgcgcgtcc tcgacacccc gattgcagaa       180
     aatagcttta cgggcatggc cgttggggct gccatgaccg gcctgaagcc gatcattgaa       240
     ggcatgaata tgggcttttt gctcctagcc tttaaccaaa ttgccaataa tgccggtatg       300
     ttgcgctaca catccggcgg caacttcaaa atccccatgg tgattcgcgg accggggggt       360
     gtgggtcgtc aattgggggc agagcactcc cagcgcctag aggcctattt ccaagccgtg       420
     cctggcctta aaattgtggc ttgttctacc ccctacaacg ccaaaggatt gcttaaagcc       480
     gccatccgtg accccaaccc agttctcttc tttgagcatg tcctgctcta taacctgaag       540
     gaagaattgc ccgaccaaga atacgtcctg cctttagaca aggccgaggt ggttcgctca       600
     ggtaaagatg tcaccatcct cacctattct cggatgcgtc accatgtcgt gcaggccgct       660
     aaaaccctaa cggagcaagg ttatgatcct gagattattg atttaatctc cctcaagccc       720
     ctcgatttcg atacgattgg agcctccatt cgcaaaaccc atcgcgtcat tgtcgtagaa       780
     gaatgtatgc ggactggggg tgtgggtgct gaaattatcg cctctattaa tgatcgattt       840
     tttgatgagc tggatgcccc agtggtgcgg ctctcttctc aagatattcc gacgccgtat       900
     aacggcatgt tagagagtct aacgattgtg cagccgcctc aaattgtgga agcggttcag       960
     cagattacgg ctcttcaggt ctaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page