(data stored in ACNUC27125 zone)

EMBL: CP000828.PE102

CP000828.PE102       Location/Qualifiers
FT   CDS_pept        109163..109753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25193"
FT                   /db_xref="InterPro:IPR025479"
FT                   /db_xref="UniProtKB/TrEMBL:B0C699"
FT                   /protein_id="ABW25193.1"
FT                   /translation="MTQQLKRRAKFVGLLSTTLLVLTSPIASAQRYQPSNSELEELHEV
FT                   AADHLDMVQAISIREGVEYCGFFGFYPGGPFAGTSPRRGRADSCEPNNPPPGFTVLASY
FT                   HTHGSYTMDADTEVPSVDDLQADIQEQIYGYVATPAGRVWFNNPERRESVMLFGPGSVV
FT                   SDPNYRECRNFAPRAQYTLPQLRQRAVNDPGGC"
     atgactcaac aactgaagcg acgagccaaa tttgtaggac tattaagcac aacactccta        60
     gttctgacct cacccatcgc ctcagcccaa cgctatcaac cttccaacag tgagctagaa       120
     gaactccatg aggttgcggc tgatcattta gacatggtcc aagccatttc catcagagaa       180
     ggggttgaat actgcgggtt tttcggattt tacccaggtg gaccatttgc tgggacttcc       240
     cccagacggg ggcgagccga tagttgcgaa ccgaataatc cacctcccgg tttcactgta       300
     cttgcctcat accatacaca tgggtcctat accatggatg ccgatacgga ggttccttca       360
     gtagatgact tacaggctga tatccaagaa caaatttatg gatatgttgc cacacctgca       420
     gggcgagttt ggtttaataa ccccgaacgg cgtgaatcag tcatgttatt cggtccaggc       480
     agcgtagtta gtgatccaaa ctatcgagaa tgtcggaatt ttgctcccag agcgcaatat       540
     acattacctc aactcagaca acgagctgtg aatgacccag gcggatgcta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page