(data stored in ACNUC5340 zone)

EMBL: CP000828.PE103

CP000828.PE103       Location/Qualifiers
FT   CDS_pept        110042..115273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25194"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6A0"
FT                   /protein_id="ABW25194.1"
FT                   /translation="MARRRILDPRLFPNWGQALTLSVLMAGLSPLSTIAKPTTLISPLG
FT                   QPTPSKTERIEPEPISVQITPIGDLDLALKLPPIPTTTRSSLQNDPAHPPLTPQEKPSE
FT                   SHSIPEPSITDLPNPPLTLAEAGWVPNSQTVPVSSIPVTPPTAQASPIAPPQASSDAPS
FT                   QTPEDPEPSASLDIPYFVDAEFRGSTRRQFGVLNLRLPVFQDEKSFAFADVHFEAGSNE
FT                   TFLGNLGLAYRRVLNTAEENPWVLGTYAFYDTTRSENGFQYHQGSLGAELISKKFEFRV
FT                   NGYLPGSNSKVVGQRTVNGVLSLQPRANGLGADVVQQTLTLETRERALAGFDFEVGHRH
FT                   HFNDKVSLGLFGGYFFFDSSATNSIDGPMARAQLEVQDPLGMNGGLLQVGSRFRFDETR
FT                   GSELEGFVRLGIPFGGPQRSEPLSLTQRLARRPIERHYEITTFAQDINLPITLTELQAA
FT                   LTGQGTLSPMGPQITAVTPPQVALNPATGQPINIFFVDGDGTAGDGTQDNPLTVAQATS
FT                   AITQANDILFFLDDAGTINTQTGLGNSLTLKPGQQALGVGTTPNFVLTVPNLGSVTIFD
FT                   AGQPQLVNGANNNVLTLANNNTIDGLAFNGQNTAPRGIAAVTGATNTTIRNSSLSNFTV
FT                   AGIQITPSTNTTIDNVVFNNNATDVIVNAANTTLTNVVSTNATGPAIQILNATGTTTLT
FT                   NVDISNAGGDGLQFANPSGTITATNVDITNAGDNGLEITDGDGTFTFDVASSITNATNA
FT                   AVNVVGGTTTITYNGTITQNNPASAVNITDKTGGTTTFNGLVTANTSTAPGVNLTNNTG
FT                   STIAFNGGLDIDTTTGTGFSATNGGTVNVTATSGDESVTTTSGAALNLSNIVANITFDS
FT                   VSSTGGTNGINLDTVTGSVGVSGTTTIANTTGDGFLATNSTGTYTFGPVTITNAGLDGV
FT                   DLSGINDATTVFNLGALTINGFTGTGINLAGANVGVTAPTVAITNTGNVGTGIDLTNTT
FT                   GNRMITLGDPTNTAGDTPSSIAGVNVGVQLNNANANFIFGDGELTVDAPSTIAATTPID
FT                   ASAVGANGTYNFLDVLFLNQTPGTGLGDLFYVDNIPGGAGTRTDPADIPLGETITNPND
FT                   IIILVDNTGMDLLDAIGTNGNDTFQLQDGQSVGSFLNGTVNLRTRGPSNVLANVTVTDP
FT                   TGNGAPTSTTTGMSSATLTLANNNQIIGVDISAMGTNGIEALGVNNATINRNRITNADN
FT                   GIRLQNLTGAVEIMDNTISQTTDDGIDLGQNNTNLDSVLISGNTVSNVGEDGIDVDVYN
FT                   NGLINSVTISNNTVSEVNTSESSGIALNVYTNGQVDTVTISGNTVSTDSLSTPGIFILS
FT                   ADNSTLNTANITGNTVMMSREDTYGIYVLSTDNSAINTANITSNRVSLLDEDLVGILAL
FT                   VNNNSTITTATISDNTLSKTGDGNTGIDVGLINSTLTTANISGNTFITTDSDNTGIEVD
FT                   LINSTLSTANISGNTFNTTVNDVRGIDIDIYNSTLTTANISANTLSLTGGDSSGVNLQL
FT                   FNGSVINTATISDNSITTTDESISIELDNSTVTTANITGNNVTTSANNADGIFVSSFYY
FT                   STINTANITGNNVTTSGTNADGIFVESYYYSTINTANITGNNVTTSGTNADGIVVIAED
FT                   DYDSRINTANISNNVILQAGRDSVRISNSDINPICTSISGNRSDSPGFAMAGGTDFNLI
FT                   SEGNTFQVVNLATVSADNNNAVFSFDGTLVPPGTPPAPFTNVASCP"
     atggctagac gtcgtattct tgaccctaga ttatttccga attggggtca agccttaacc        60
     ctaagtgtat tgatggcggg gctatccccc ctgtctacca ttgccaaacc cactacctta       120
     atttctcctc taggacaacc cactccctca aagacggagc gaattgagcc agagccgatc       180
     tccgttcaaa tcactccaat aggtgattta gaccttgcac ttaaactccc ccccataccc       240
     accacaacca gatctagcct tcaaaacgac cctgcacacc ctccccttac ccctcaggag       300
     aagccctcag aaagccattc aatccccgaa ccctctatca cagatctgcc caatccccct       360
     ctcaccttag ccgaagctgg atgggttcct aattcccaga ctgtcccagt ctcttcgatt       420
     ccggtaactc ccccaacagc ccaggccagc ccaatagctc ctccccaagc ttcttcggac       480
     gctccatctc agacaccaga agatcccgaa ccttcagcca gcctcgatat cccctacttc       540
     gtcgatgctg aatttcgcgg tagcacccgt cgccagtttg gcgtcctcaa cctccgcctc       600
     cccgtcttcc aagacgaaaa atcctttgcc tttgctgatg tccactttga agcaggtagc       660
     aacgaaacct tcctggggaa cctcggtctc gcctatcgcc gtgtcctcaa caccgccgaa       720
     gagaatccct gggtcctcgg tacctatgcc ttctacgaca caacccgcag tgaaaacggc       780
     tttcaatatc accaaggtag cctcggcgca gaactcatta gcaagaaatt tgagtttaga       840
     gtcaacggct atcttccagg cagtaactct aaagtggtgg gtcaacgcac cgtgaatggt       900
     gtccttagcc ttcaacctcg tgctaatggc ctaggtgcgg acgttgtcca acaaaccctg       960
     acactagaaa ctcgggaacg cgccctagcg ggcttcgact ttgaagtcgg ccatcgtcat      1020
     cactttaatg acaaagtcag ccttggtctc tttggtggct acttcttctt tgatagcagc      1080
     gccaccaaca gtatcgacgg ccccatggcc cgtgcccaac tcgaagtcca agacccctta      1140
     ggcatgaatg ggggactcct ccaagtcggc agccgcttcc gcttcgatga aacccgtgga      1200
     tccgaacttg aaggctttgt ccgcctcggg attccctttg gcggccccca acgatctgaa      1260
     cccctgagtc tgacccagcg attagctcgc cgccccattg aacgccacta tgaaatcacc      1320
     acctttgctc aggacatcaa tctccccatc acccttaccg aactgcaagc tgcccttacc      1380
     ggtcaaggta ctctttctcc aatgggccca cagattactg cagtgacacc tccccaagtt      1440
     gcactaaatc ctgcgactgg acaaccgatt aatattttct ttgtcgatgg tgatggtaca      1500
     gcaggtgatg gcacgcaaga taaccccctg acagttgctc aagctaccag tgccatcact      1560
     caagccaacg acatcctctt cttcttagat gatgccggca cgattaatac ccaaacaggc      1620
     ctaggaaact ccctaaccct aaaacctgga caacaagccc ttggggtagg aaccactccc      1680
     aacttcgtcc tcactgtacc taacctcggc tcagtcacca tctttgatgc cggacaaccc      1740
     caactggtca atggtgccaa caacaacgtc ctcaccctcg ccaataacaa caccattgat      1800
     ggtcttgcct tcaacgggca aaacactgct cctagaggaa tcgccgccgt tacaggagcc      1860
     accaacacca ccatccgtaa cagcagcctc agcaatttca ccgtcgctgg tattcagatc      1920
     accccctcca ccaacaccac catcgacaac gtcgtcttta ataacaacgc cacagacgtt      1980
     atcgtcaatg ccgccaacac gaccttaacc aacgttgtga gcaccaacgc cacaggtccc      2040
     gccattcaga tcctcaatgc tacgggcacc accaccctca ccaatgtcga tatctctaac      2100
     gctggtggag atggtctcca gtttgctaat ccctccggca ccatcaccgc aacgaatgtg      2160
     gatatcacga atgcgggtga taacggcctt gagattacgg acggcgatgg cacctttacc      2220
     tttgatgtgg ctagctcgat taccaatgct actaatgccg ctgtcaatgt agtcggtggc      2280
     accaccacga ttacttacaa cggtaccatt actcaaaaca atcctgcgag tgccgtcaat      2340
     atcactgata agacaggcgg caccaccacc tttaatggct tagtcaccgc caatacgagt      2400
     acagcacctg gcgtaaacct gaccaacaat acgggtagta cgattgcctt caatggtggc      2460
     ctagatattg ataccactac cggtaccgga tttagcgcca ccaatggcgg caccgtcaat      2520
     gtcactgcca caagtgggga tgaatcggtt actacgacca gtggcgctgc cctgaacctc      2580
     agcaatatag tggccaacat cacctttgat tcagtgtctt cgaccggggg aacgaatggc      2640
     atcaacctgg atacagtgac aggctcggtg ggtgtctctg gaaccactac aattgccaac      2700
     acgactggag atgggttctt agcgaccaat agtacaggga cctatacctt tggtcctgtg      2760
     accatcacca atgctgggtt agatggtgtg gatctatcag gaattaatga tgccactaca      2820
     gtgtttaact tgggggcatt gacgattaat ggctttacag gaacagggat taatctggcg      2880
     ggggcgaatg tcggcgtcac ggctcccacg gtggcgatta ccaatacggg caacgtgggc      2940
     acggggattg acctgacgaa tactacgggc aatcggatga ttaccttagg tgatccaacg      3000
     aatacggctg gagatactcc tagttcgatt gctggagtaa atgttggggt gcagttgaat      3060
     aatgccaatg ccaactttat ctttggggat ggggagttga cggtggatgc tcccagtacg      3120
     attgcagcga cgactcccat tgatgctagt gcggtggggg caaatggtac ctataacttc      3180
     ttggatgtgc tgttcttaaa tcaaacgcca ggaactgggt tgggcgattt attctatgtg      3240
     gacaatatcc ctggaggagc aggaacacga acagatccgg ccgatatccc tctgggtgaa      3300
     acgattacga atcccaatga catcattatc ctggtggaca atacagggat ggatcttttg      3360
     gatgcgatag ggacgaatgg aaatgatacg ttccaattac aggatggcca aagtgtgggg      3420
     agtttcctta atggtacggt caatctccgc acgagaggac catccaatgt cttggcgaat      3480
     gtgacggtga cggaccccac agggaatggt gcaccgactt caacgacgac agggatgagt      3540
     tctgcaacac tgaccttagc caacaacaat cagattatcg gagtcgatat ctcggcaatg      3600
     ggaaccaatg ggattgaagc attgggggtt aacaatgcca ccattaatcg caatcgaatt      3660
     acgaatgcgg ataatggaat tcgtttgcag aatctgacgg gtgcggtgga gattatggat      3720
     aatacgatct cccaaacgac ggatgatggg attgacctag gccagaacaa caccaatctc      3780
     gacagtgtgt tgatttcggg taatacggtt agcaatgtgg gtgaagatgg gattgatgtc      3840
     gatgtttaca acaatggtct aatcaactca gtaaccatct cgaataatac ggtaagcgag      3900
     gttaatactt cagaatcaag cggtattgcg ctcaatgtct acaccaacgg ccaagtcgac      3960
     acagttacaa tttcggggaa taccgtgtca acggattcac tatctacacc tggcattttc      4020
     attttgtctg ctgacaatag cacccttaat accgccaaca tcacgggtaa caccgtgatg      4080
     atgtcgcgcg aagacaccta tggcatttat gttttatcga ctgataatag tgcgattaat      4140
     acagccaata ttactagcaa tcgggtgtca ttattagatg aagatctcgt cggtatttta      4200
     gctttagtaa ataacaacag cacaattaca acagctacta tttctgacaa taccctctct      4260
     aaaaccgggg atggtaacac cggcattgat gttggtctta ttaacagcac actgacaact      4320
     gctaatattt ctggcaacac ttttatcacg accgacagtg ataataccgg cattgaagtt      4380
     gatcttatta acagcacact gtcaactgcc aatatttctg gcaacacttt taatacgacc      4440
     gtgaacgatg tgcgaggcat tgatattgat atctataaca gcacactaac gactgccaat      4500
     atttcagcca ataccctatc cctcacgggt ggtgattcaa gtggtgttaa tctccagctt      4560
     tttaacggta gcgttatcaa cacagccacc attagcgaca atagcatcac aacgacagat      4620
     gaaagcatct ctatcgaatt agataacagt acggtcacta cagctaacat tacgggcaat      4680
     aatgtaacaa cttctgctaa caatgctgat ggtatttttg taagctcctt ctactacagc      4740
     actattaata cagccaacat tacgggcaat aatgtaacaa cttctggaac taacgctgat      4800
     gggattttcg ttgagtctta ctactacagc actattaata ccgccaatat tacgggcaat      4860
     aatgtaacaa cttctggaac taacgctgat ggcattgttg tcatcgctga agatgactat      4920
     gacagtcgaa ttaacaccgc taacatctcc aataatgtca ttctccaagc gggtcgagat      4980
     agcgtgcgga taagtaatag tgacattaat cctatctgta catccatttc aggcaaccgt      5040
     agtgatagtc ctggctttgc gatggccggt ggaacagact ttaacctaat ctctgaagga      5100
     aacactttcc aggttgtaaa tttagcgacg gtcagtgccg acaataacaa tgccgtcttt      5160
     agctttgacg gcaccttggt tccacccggt actccccctg cgccctttac gaatgtggcc      5220
     agttgtccct ag                                                          5232
//

If you have problems or comments...

PBIL Back to PBIL home page