(data stored in ACNUC5340 zone)

EMBL: CP000828.PE106

CP000828.PE106       Location/Qualifiers
FT   CDS_pept        117347..117559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25197"
FT                   /db_xref="InterPro:IPR019678"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6A3"
FT                   /protein_id="ABW25197.1"
FT                   /translation="MNVTHSENKNVSGFTEEDVALLAKRLEEDDYETPFAALEDWHLLR
FT                   SIAFQRPELTESYLYLLDLEAFDES"
     atgaatgtta cacacagcga aaacaaaaat gtttcagggt tcaccgaaga ggatgtagcg        60
     cttcttgcca agcggttaga agaagatgac tacgaaaccc cctttgctgc tttggaagat       120
     tggcatttgc tccgatcgat tgccttccaa cgtccagaac taactgaatc ttatctatac       180
     ctattagatc tagaagcatt cgacgaatcc taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page