(data stored in ACNUC27125 zone)

EMBL: CP000828.PE11

CP000828.PE11        Location/Qualifiers
FT   CDS_pept        10405..11535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0013"
FT                   /product="DUF6 domain transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25102"
FT                   /db_xref="GOA:B0C4Z0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z0"
FT                   /protein_id="ABW25102.1"
FT                   /translation="MCFETSLNKANFSFQSLLRVIMQFSLPHSQRIPNRLTLIAPFFLW
FT                   GTAMVAMKGVLAHTTPLFMGGLRIAPAGLLVIGVALLLGKSQPKGWRAWLWILLFALVD
FT                   VTLFQGFLALGLSHTSAGLGSVMIDSQPLVVALLALVLYGERIGLWGWLGLGIGVSGIS
FT                   CIGLPDEWILQLGSGEWLQQDWQQVFNWQYLNQLTQSGEFLMLLAALSMAVGTVMIRQV
FT                   CRYADPISATGWHMVIGGLPLFIGSGLWESEQWVHLTQIDWLSIGYAAVFGSAVAYGLF
FT                   FYFASKGNLTSLSSLTFLTPVFALIFGNLFLAEVLSPIQTLGVCLTLVSIYFVNQREQL
FT                   PTLGHLWSSLELRMLGTKDSKTAEIPVRVDPKTTVK"
     ttgtgctttg agaccagctt aaataaagcc aatttctctt ttcaatcctt gctacgggtc        60
     attatgcaat ttagtctgcc tcactctcaa cgcattccca atcgtctgac cttgatcgcc       120
     cccttcttcc tatggggaac cgcgatggtt gccatgaagg gggttttggc tcacaccact       180
     cccctcttta tggggggctt gcgcattgcc cccgctgggc ttctggttat cggagtcgct       240
     ctactcttgg gtaagtctca gcccaaggga tggcgagcct ggctatggat attgctattt       300
     gccctagtcg atgtcaccct attccaaggt tttcttgcat tagggctctc ccatacctct       360
     gcagggcttg gttctgtgat gatcgattca cagcccctcg tggtggcctt actggcgctg       420
     gtcctatatg gggagcgaat tgggctgtgg ggatggttgg gattaggcat tggcgtgagc       480
     gggattagct gtattgggtt gcctgatgaa tggattttac agttggggtc tggggaatgg       540
     ctgcaacaag attggcagca ggtttttaat tggcaatacc taaatcagct cactcaaagt       600
     ggggagtttc tgatgctgct agcggccctg tcaatggcag tggggaccgt gatgatccgc       660
     caagtgtgcc gttacgccga ccccatcagt gccaccggtt ggcatatggt cattggggga       720
     cttcccctgt ttatagggtc tggactttgg gaatctgagc aatgggtcca tctaacccaa       780
     attgattggc tctctattgg ctatgctgcc gtttttggca gtgcagttgc ctatggcctc       840
     tttttctatt tcgcgtctaa gggtaactta accagcctca gttccttaac atttttaacg       900
     ccagtctttg ccctgatctt tggcaatctg tttttggcag aagttctcag cccgatccaa       960
     accctgggcg tctgcctcac cctcgtcagt atttatttcg ttaaccaaag agagcagctt      1020
     cccaccctgg gacatctatg gtcgtctcta gagcttcgga tgttgggtac caaagattct      1080
     aaaactgcgg agattccggt ccgagttgat cccaaaacga ccgttaaata a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page