(data stored in ACNUC27125 zone)

EMBL: CP000828.PE110

CP000828.PE110       Location/Qualifiers
FT   CDS_pept        120126..120743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0114"
FT                   /product="glutaredoxin-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25201"
FT                   /db_xref="GOA:B0C6A7"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6A7"
FT                   /protein_id="ABW25201.1"
FT                   /translation="MSGHEVNITLYRWAGAWGPFKVKIPCGECTLTKDVILDTLENELA
FT                   GIPVILEIREWLTEWWKPLLKGGWHAPIVMVNGKVISQGHALNRGLLTEAVTAAYASKA
FT                   PIQRSHLFGKESCPHCKRAKAYLDQVGIQYTYHDVVRSPRALYEMLARVKPLVGPKTPI
FT                   TVPQIWLGGQYIGGADRLEQVMQEQGLFRPEFNTVKTTLQPR"
     atgtcaggcc acgaagttaa tatcaccttg taccgatggg cgggagcatg gggccctttt        60
     aaggtcaaaa ttccttgtgg tgaatgtacc ctgaccaaag atgtcattct agacaccttg       120
     gagaatgagt tagcgggcat tcccgtcata ctcgaaattc gcgagtggct cacagaatgg       180
     tggaagccct tactcaaagg gggatggcat gctccgattg tgatggtcaa tggcaaagtg       240
     attagccaag gtcatgcact gaatcgagga ctactgacag aagccgttac agccgcttac       300
     gcatccaaag cccccatcca aagaagccat ttatttggga aagaaagctg tcctcactgc       360
     aaacgcgcca aagcctattt agaccaagta ggtattcagt acacctacca cgatgtggtt       420
     cgcagccctc gcgcactcta cgaaatgttg gcccgagtaa agcccctcgt tggccccaaa       480
     acccctatca ctgttcccca aatttggttg ggaggacaat atatcggggg agcggatcga       540
     ctagagcagg tcatgcaaga gcaaggatta ttccggcctg agttcaacac tgtgaagact       600
     actcttcaac ctagataa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page