(data stored in ACNUC27125 zone)

EMBL: CP000828.PE113

CP000828.PE113       Location/Qualifiers
FT   CDS_pept        122479..122940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0117"
FT                   /product="4-carboxymuconolactone decarboxylase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25204"
FT                   /db_xref="GOA:B0C6B0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6B0"
FT                   /protein_id="ABW25204.1"
FT                   /translation="MTQRFDFSQSDPKAHQAMLGLEAYLRQCGLPPQLLHLIKTRASQL
FT                   NGCAFCIDMHTKEARADGESEQRLYALSAWAETPFFTPAERAALALTEVVTRISEQAVP
FT                   DAVYAEACQHYSEAEVTQLLIAIVTINSWNRLVIASQVLPGSYTVPVAA"
     atgacgcaac gattcgattt cagtcaatcc gatccaaaag cccatcaagc gatgctgggg        60
     ttggaagcct atctccgtca gtgcggcctg ccgccacaat tgctgcattt gatcaaaacc       120
     agagcttctc agcttaacgg ctgtgccttt tgtattgata tgcataccaa agaggccaga       180
     gctgatggag aatcggagca aaggctctat gccctcagtg cctgggcaga aacacccttt       240
     ttcacacccg cagaacgagc tgccctagcc ttaactgagg ttgtcacccg gatctctgag       300
     caagcggttc ctgatgcggt ctatgctgaa gcgtgccaac attactcaga agcagaagtg       360
     acacagctac tgatagcaat tgtgaccatc aatagttgga atcgtctggt gatcgcatcc       420
     caagtcctgc ccggtagcta cactgttcca gtcgccgctt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page