(data stored in ACNUC27125 zone)

EMBL: CP000828.PE114

CP000828.PE114       Location/Qualifiers
FT   CDS_pept        122949..123353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25205"
FT                   /db_xref="GOA:B0C6B1"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6B1"
FT                   /protein_id="ABW25205.1"
FT                   /translation="MSHQTTPITRVVIAHTLISALHGLAHLLIPVPISVLQALFIAGVI
FT                   SALPIVAVVLVWRQQVKWASTVLLVSMAGSLLFGLYNHFVVISPDHFSQMPPTSLGVLF
FT                   QVTAILLAVSEGIGIGVSVWALNPRQPLIP"
     atgagtcatc aaacaactcc catcacccga gtggtgatcg cccatactct gattagtgct        60
     ctacatggcc tagcccatct gctcattccg gttccgatct cagtcttaca agccctgttt       120
     attgcggggg tgatttcagc gctgccaatc gttgccgtgg ttttggtctg gagacagcag       180
     gttaaatggg cttcaacggt gctgttagta tcgatggcag ggtctcttct ctttggtctg       240
     tacaaccact ttgttgttat cagccccgat catttttctc agatgcctcc cacgagtttg       300
     ggagttctat ttcaggtcac ggcaattcta ctggccgtct cggaaggcat tggtattgga       360
     gttagtgtat gggcactcaa ccctcggcag cctctcatcc cttaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page