(data stored in ACNUC27125 zone)

EMBL: CP000828.PE124

CP000828.PE124       Location/Qualifiers
FT   CDS_pept        complement(128563..129672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25215"
FT                   /db_xref="GOA:A8ZM09"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZM09"
FT                   /protein_id="ABW25215.1"
FT                   /translation="MVERFGTLGVSPHLSSTPMIKIDFTAEEIQQLNYERYHHPHPRVQ
FT                   RRMEVLYLKSQGLSHTQICQLCQISRPTLAKTLRQYQQGGIEGLKTLEYKGQPSLLNAH
FT                   SDSVRAYFEQHPPRTSAEAQAVIEQLTGIKRSPTQIKAFLKRIGCRYRKVGYVPGKSSL
FT                   PEKIEEQEQFRHTRLEPLLEEAQRQERLVFFVDAAHFVHRAYLGFVWCITRIFIPSPSG
FT                   RQRFNVLGALDAITKDLVSVTNHTYINSHSMCLLLAKLALLDPVIPISVILDNARYQKC
FT                   QLVTDFAEIVDIELVYLPSYSPHLNLIERLWRFVRKECLYSKYYADFPAFKGAIQQCID
FT                   QCNGEHKAKLTTLLSLKFQSFKKVNILAA"
     gtggtagaga gatttggcac actgggagta tccccgcacc tatcctccac tcccatgatt        60
     aaaattgatt tcaccgcaga ggaaatccaa caactcaatt acgaacgcta tcatcaccct       120
     cacccacggg tgcagcgacg gatggaagtg ctctacttga agagtcaagg tctttcccat       180
     acccagatct gccagctttg tcagattagt cgccccactt tagccaaaac tcttcgtcag       240
     tatcaacaag gagggattga agggctgaag acccttgaat ataaaggtca accgagtcta       300
     ctcaacgctc atagcgatag tgtgagagct tactttgagc aacatcctcc ccgcaccagt       360
     gcagaagctc aagcggtcat tgagcaatta acaggcatca aacgcagtcc cacccaaatc       420
     aaagccttcc tcaaacgcat cggttgtcgt tatcgaaaag tggggtatgt gccgggaaag       480
     tcgagtctgc ccgagaaaat tgaggagcaa gagcagtttc gacacactcg ccttgaaccc       540
     ttattagagg aagctcaacg ccaagagcgt cttgtctttt ttgtggatgc tgctcacttt       600
     gttcaccgtg cttatctagg gtttgtctgg tgcatcactc ggatcttcat cccttctcct       660
     tctggtcgcc aacgtttcaa tgtcctgggc gcgctcgacg ctatcaccaa agacctagtc       720
     agcgttacca accacaccta tatcaattct cacagtatgt gcctgttact ggccaagctg       780
     gcgctacttg acccagtcat acccatcagc gtgattttag acaatgcgcg ataccagaaa       840
     tgtcagcttg taacggactt tgccgagatc gtcgatattg agctggtcta tctgccctcc       900
     tattcacccc atttgaattt gattgagcga ctctggcgtt ttgtacgcaa ggaatgtctc       960
     tattcaaagt attatgctga ttttcccgcc ttcaaagggg ccattcaaca gtgcatcgac      1020
     cagtgtaatg gagagcataa ggcgaaactc accaccttac tatcactcaa gtttcagtct      1080
     tttaagaaag ttaatatctt agccgcctag                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page