(data stored in ACNUC27125 zone)

EMBL: CP000828.PE132

CP000828.PE132       Location/Qualifiers
FT   CDS_pept        complement(135628..136488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0137"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Putative multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25223"
FT                   /db_xref="GOA:B0C6C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6C9"
FT                   /protein_id="ABW25223.1"
FT                   /translation="MNSSVSLQNISKIYNQVSVVNDLSLAIQSGEIFGLLGPNGAGKST
FT                   TIRMMTTLTKPSQGNIQIAGLDIDQGQQIKRKIGVVLQQVSLDQDLTVWENMEMHGRLH
FT                   HLPKSLRQDRIHHYLDYVDLLQRQQDVVRQLSGGMMRRLQIARALLHQPQILFLDEPTV
FT                   GLDPQSRRRIWEIIQELNHQGMTIVLTTHYMEEVESLCDRIGIIDKGQLIALGTLAELK
FT                   QQHGDGLLVKQVGESSRPQWDYQFFPTLAAAQDYLDHQTNRVGMMVRPANLEDIFVELT
FT                   GRNLD"
     atgaattcat ctgtttctct tcagaatatt tccaaaatct ataatcaggt ttcagtggtc        60
     aatgacctgt ctttagcgat tcaatcaggc gagatatttg gactgctagg accgaacgga       120
     gccgggaaat caaccacgat tcggatgatg accaccctca ccaaaccgtc tcaaggaaat       180
     attcagattg cggggctgga tattgatcag gggcaacaaa ttaagcgcaa aattggtgtt       240
     gtcttacagc aggtcagttt ggatcaggat ttaacggttt gggaaaatat ggagatgcat       300
     ggccgcctgc accatttacc caaatccctc cgtcaggata gaattcacca ctacttggac       360
     tatgttgatc tgctgcagcg acagcaagat gttgtccgcc aactgtcggg cgggatgatg       420
     cgtcgactgc aaattgccag agcgctccta catcagcctc aaattttatt tctggatgag       480
     ccaacggtcg ggcttgatcc ccaatcaagg cgaagaattt gggaaattat ccaggagtta       540
     aatcaccaag gaatgacgat tgtactgacc acccactata tggaagaggt ggaatcctta       600
     tgcgatcgca tcggtattat cgacaagggc caactgattg ccctaggcac cctggcagaa       660
     ctcaaacaac agcatggaga tggattgttg gttaaacagg tgggagaaag tagccgtccc       720
     caatgggatt accaattttt ccccacctta gcggcagccc aagactatct ggatcatcag       780
     accaatcggg tgggaatgat ggttcggcct gccaacctag aagatatttt tgtggagctg       840
     acgggacgca atttggatta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page