(data stored in ACNUC27125 zone)

EMBL: CP000828.PE140

CP000828.PE140       Location/Qualifiers
FT   CDS_pept        complement(144877..145008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25231"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6D7"
FT                   /protein_id="ABW25231.1"
FT                   /translation="MIVMLMVTLFWLSNSWPNLLPGSPLPVQEQNQIINPSLNWPQS"
     atgattgtca tgctcatggt taccctattt tggctgtcaa attcttggcc caatctgctg        60
     cctggttctc ctttgcccgt ccaagagcaa aatcaaatta tcaacccttc tctaaattgg       120
     ccgcagtcct ag                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page