(data stored in ACNUC8465 zone)

EMBL: CP000828.PE143

CP000828.PE143       Location/Qualifiers
FT   CDS_pept        147100..147852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25234"
FT                   /db_xref="InterPro:IPR031975"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6E0"
FT                   /protein_id="ABW25234.1"
FT                   /translation="MVPFGEDSTKRTTNVIFQMIMAWLRNRYWICVIASSLLIGCSGSE
FT                   TAKQSPQPSVNSPAPKSTPQAPQTSPKVSPKATTAAKPASQPKPAAPKPVSAPAKVKLS
FT                   PAPKVELSKSEKQLVSKVQKEVQKNGSVAKQDTGHTYLGNVLRSQQAEKLVTGRFTTNL
FT                   QKLESDSPKDSGEFQLQVLEANENKAIVAAIAKQNGIFSYTGAVYAQDASIPVSAICKS
FT                   NEPTQTPPGTPKLTGSTIVCAQGSTVVE"
     atggttcctt ttggggaaga ctcaactaag agaacgacaa atgttatttt ccaaatgatt        60
     atggcttggc ttagaaacag atattggata tgtgtgattg cgagtagctt actgatcggc       120
     tgttcaggct cagaaacagc aaagcagtct cctcaaccca gcgtaaattc tccagcaccc       180
     aagagcacac ctcaggctcc tcaaacctct cctaaggtct ctcctaaggc caccacagcg       240
     gcaaagccag cgtctcagcc taaacctgca gcgccaaaac ctgtatctgc tccagcgaag       300
     gtgaagctct cacccgcgcc taaagtggaa ctatcaaaat cagaaaaaca gctggtcagc       360
     aaagtccaaa aagaagtgca gaaaaacggc tctgttgcta aacaggatac cggccacact       420
     tatctgggca atgttctgag atcgcaacag gctgagaagt tagtcaccgg ccgattcacc       480
     accaatttac agaaattaga atctgattcc cccaaagata gcggtgaatt tcaactgcaa       540
     gtgctagagg ccaatgagaa taaggccatc gtggctgcga tcgcaaaaca gaacggcatc       600
     tttagctaca cgggtgcggt ctatgcccag gacgccagca ttcccgtttc tgcaatttgc       660
     aaatcgaatg agcccactca aactccaccg ggtactccaa agctcacagg ctccacaatt       720
     gtctgtgccc aaggctcaac ggtggttgaa tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page