(data stored in ACNUC5340 zone)

EMBL: CP000828.PE145

CP000828.PE145       Location/Qualifiers
FT   CDS_pept        complement(149264..150814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25236"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6E2"
FT                   /protein_id="ABW25236.1"
FT                   /translation="MLLKSCGLFLGLIVAGSGDAIATPNDLQSLDRGHRILIQRGLQLN
FT                   ALTIGFTIKGRENDSELWQNWEASNFTTLDIGRGQLASSETIAGQKPWSTWQANAQDSA
FT                   QSLPDRIFQSDQIQNLVSWQFKDEQDIGKESELQELETWIKHYRPLLPNTLLYTNQHGD
FT                   ERFGGFGSTSDLNIQRYMRRIQPDLLMQDTYPYGIWNDLGNQGGRPAQLYYAMMRYRRL
FT                   ALAGNDGTGRKPIPYGLWLQTFKGSATGVGTWSRFPSESELSQQQFAALTLGFKLLNAF
FT                   TYNGTSDVGGKLNAPFFKQPFGKDPTPAFQHIAEINQHSLNLGPTLVRLLSTDVRIVPR
FT                   PPTLADLIAPEIPHWDAKADPYMTSLEVKNLGNLYGGRNGDVLVGYFKPLRESFDGPAT
FT                   NQQYFMLTNGLAGKRHSIEQTRQQLTVEFDFGESEITGLQRLNRKTGKVESIQAGWREE
FT                   VASGLTSQFDVLGDHKYRLTLILDGGTGDLFKFGTGAPFVGQSTVQQSIQTSSKSGEN"
     atgcttctca aaagctgtgg attgtttttg ggactgattg tggctggaag cggtgatgcg        60
     atcgcaacgc caaatgacct ccaatcacta gatcgtggcc atcgaatctt gattcaaagg       120
     gggctacagc tcaacgccct caccattggc ttcaccatta aaggcagaga aaacgattcc       180
     gagctttggc agaactggga agcgagcaac tttaccaccc ttgatattgg taggggacaa       240
     cttgcttctt ccgaaacaat cgctgggcaa aagccctggt ctacttggca agccaatgcc       300
     caagattctg cccaaagcct tcctgatcgt atcttccaat ccgaccaaat tcagaatctt       360
     gtcagttggc aatttaaaga cgaacaagat attggcaaag aaagtgaact tcaagaatta       420
     gaaacttgga tcaaacatta ccgaccgctt cttcccaata cccttctcta taccaaccag       480
     catggtgatg aacgctttgg cggctttggc agtaccagtg acctcaatat ccaacgctat       540
     atgcgtcgca tccagcccga tctactgatg caagacacct atccctatgg aatctggaac       600
     gatttgggta atcaaggcgg acgtcccgcc caactgtact acgcgatgat gcgctatcgt       660
     cgattagcct tggctggcaa tgacggcaca gggcggaagc ccattcccta cggattatgg       720
     cttcaaacct ttaaaggatc tgcgactggc gtagggactt ggtcgcgttt cccttcggag       780
     tcggaactga gtcagcaaca attcgcagcc ttaaccctgg gatttaaact ccttaatgcc       840
     tttacctaca atggcactag tgatgttgga gggaaattaa acgctccatt ttttaaacaa       900
     ccctttggaa aagatcccac gccagctttt caacatatcg ccgagatcaa ccaacacagc       960
     ctcaatctag gaccaactct cgttcggctg cttagcacag atgtacgaat agtgcctaga      1020
     cctccgactc tcgcagattt aattgctccc gagattcccc attgggatgc caaggctgat      1080
     ccttacatga ccagtctaga ggttaaaaac ctgggaaatc tatatggtgg gcgtaatggt      1140
     gatgtgttgg taggctattt caagccttta cgagaaagtt ttgatggccc tgcaactaac      1200
     cagcagtact ttatgctcac caatggatta gctggcaaga gacattcgat tgaacaaacg      1260
     cgtcagcagc tcaccgttga gtttgatttt ggtgagagcg agatcacggg attacaacgt      1320
     cttaaccgta agacgggcaa ggtggaatcc attcaagctg gatggcgcga ggaggttgcc      1380
     tcaggactga cgtctcagtt tgatgtcctg ggcgatcaca aataccgtct caccctcatc      1440
     ttagatggcg gaacgggaga cctattcaaa tttggtacgg gtgcaccgtt tgtcggccaa      1500
     tctactgttc aacaatcgat tcaaaccagc tccaagagtg gagagaattg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page