(data stored in ACNUC27125 zone)

EMBL: CP000828.PE15

CP000828.PE15        Location/Qualifiers
FT   CDS_pept        complement(16489..18813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0017"
FT                   /product="sensor histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25106"
FT                   /db_xref="GOA:B0C4Z4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Z4"
FT                   /protein_id="ABW25106.1"
FT                   /translation="MFIQTLRSFPGKLARRHKLRTVLVVPFVLQVCGAVGLVGYLSFQN
FT                   GQRSIESLAQQLTDEVEVHIAERTQTYLAAPHAVNQLNQNALELGQLSADNLNSMERHF
FT                   WRQIQVFDRISYIQFGTPKGEFVGLAANDDGSFTYQVTEYSGDLQTYAIKQNGQRGKKL
FT                   ETSPNFEPQKRPWYLIPEKKDKPTWTDIYAWVNPPTLAITLGQPYYDQSGTFQGILATD
FT                   LSIAQFSDFLQTLKIGKTGKSFILERSGLMVATSTAEEPFTPSEKGPQRLPALESKDPV
FT                   VRATTQTLLDRFGTLQEISVRQQLTIDIEGKRYFLQVNPLRDQHGLDWLSVVVVPEADF
FT                   MEQIYANTRSTIGLSVAALLFAILIGVSTARWVTNPILKINAAATAISSGDLQRSVALN
FT                   RSDELGELARSFNQMVQDLRISLEERNVVVEALKKSEQQLAEYNRSLEQEVQQRTQELV
FT                   QSEKMVALGQLTAGVAHEINTPLGAIQAAGENIASSLEKSMQQLPKILDQLQPEQTDAF
FT                   FELLAMAQQQELLTSREERKLKRSLKKILAEKSLEPANDMASTLSKMGVSADLSSFLPI
FT                   LELPNNTEVLDVAYDLTVIHNNTQNIRLAVGRAAKIVFALKSYARQDLSNEKVKASVTD
FT                   TVETVLTLYHNQIKHGIDLTKDFEDVPDILCYPEELAQVWTNLLHNAMQAMDYKGHIQL
FT                   TIGQEQQGILVSFTDSGSGIPEDVQAKIFDPFFTTKPAGEGSGLGLDIVRKIVDKHQGK
FT                   VECQSQPGHTRFEVWLPLEVS"
     atgtttattc aaacgctgcg atccttccct ggaaaactcg ctcgtcgcca caagctcaga        60
     acggtcctgg ttgtaccttt tgtattgcag gtttgcggtg cagttggtct ggtcggttat       120
     ttatcatttc agaatggtca acgatcaatt gaatccctgg ctcagcagct gacagatgaa       180
     gtggaagtcc atattgctga gcggacccaa acctatttgg ctgctcccca tgccgttaac       240
     cagcttaatc agaatgcttt agaactcggg cagctgagcg ccgataacct caacagtatg       300
     gaacgccatt tttggcgaca gatccaggta tttgatcgga ttagctatat tcagtttggg       360
     acgcccaaag gagaatttgt cgggctggca gcgaatgatg atggtagttt tacttatcag       420
     gtaacggagt attctgggga tttacaaacc tatgccatta aacaaaatgg acagcggggg       480
     aaaaaattag aaacatctcc taattttgaa ccccaaaaac gtccttggta tttaattccc       540
     gaaaaaaaag ataagccgac ttggaccgat atttatgctt gggttaaccc tccgacttta       600
     gccattacct tagggcaacc ttattatgat cagtccggaa cctttcaagg tatcttagca       660
     acggatctat cgattgctca gtttagcgat tttctgcaaa ccctcaagat tggtaaaaca       720
     ggcaagagtt ttatcctgga gcgctcagga ttaatggttg ctacttctac ggccgaggag       780
     ccctttacgc cttccgagaa aggtccacag cgtttaccag ccctggaaag caaagatccc       840
     gttgtccggg caaccactca aacattattg gatcggtttg ggactttgca ggagatttcg       900
     gttcgccaac agctcaccat cgatattgag ggcaagcgtt attttctcca ggtgaatccc       960
     cttcgagatc agcatggttt agattggctc agtgtggttg ttgttccaga agcagacttt      1020
     atggaacaaa tttatgccaa tacccgctca accattgggc tatcggttgc tgcgctgcta      1080
     tttgcgatcc tcattggggt gtctaccgcc cggtgggtga cgaatcccat cttgaaaatc      1140
     aacgctgctg ctacggctat ctcttcagga gatttgcagc gaagtgttgc tctcaaccgc      1200
     tcggatgagt taggagaatt agcacgatcg tttaatcaaa tggttcaaga tctgcgcatc      1260
     tccttggaag aacgaaatgt ggtggtagag gcactcaaaa agagtgaaca acagttagca      1320
     gaatataacc ggtctctaga acaggaggtt caacagcgaa cccaggaact ggttcaatct      1380
     gaaaaaatgg tggcgttagg ccaactcacc gcaggggttg cccatgaaat caatacgccc      1440
     ttgggggcga ttcaagctgc cggagaaaat attgcatctt ctctagagaa gtccatgcag      1500
     cagctcccca aaatcctgga tcaattacag ccagaacaaa ccgacgcatt ttttgagtta      1560
     ttggcgatgg ctcagcaaca ggagctgtta acctcccgcg aggagcgtaa gctgaaacga      1620
     agtttgaaga aaatcctggc agagaaaagc ttagagcctg ccaatgatat ggctagtacc      1680
     cttagtaaga tgggggtctc tgctgatctt tcgtcgtttc tacccattct ggagttgccg      1740
     aacaataccg aagttctgga tgttgcctat gatttgacgg tcatacataa caacactcag      1800
     aatatccgct tggctgtagg acgggcagcc aaaattgtgt ttgctctgaa gagctatgct      1860
     cgccaagatc tgagtaacga gaaagtcaaa gcgtcagtta cagacacggt agagacggtt      1920
     ctgaccttgt accataacca gattaaacac ggtatcgact tgactaaaga ctttgaggat      1980
     gtcccagata ttctgtgcta tccagaagaa ctggctcagg tgtggacgaa tctgctgcac      2040
     aatgccatgc aggctatgga ttacaaaggc cacattcaat taaccattgg ccaggagcag      2100
     caggggattc tggtcagctt tacggattca ggcagtggta ttcctgagga tgtgcaagcc      2160
     aagatctttg atcccttttt cacgacaaaa cctgctggcg aagggagtgg tttgggacta      2220
     gatatcgtcc gtaaaattgt cgataaacac caagggaagg tcgaatgtca gagtcagcca      2280
     gggcatacta ggtttgaggt ctggttaccc cttgaggtga gctaa                      2325
//

If you have problems or comments...

PBIL Back to PBIL home page