(data stored in ACNUC27125 zone)

EMBL: CP000828.PE154

CP000828.PE154       Location/Qualifiers
FT   CDS_pept        complement(157185..158675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0159"
FT                   /product="rieske 2Fe-2S domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25245"
FT                   /db_xref="GOA:B0C7I5"
FT                   /db_xref="InterPro:IPR013626"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7I5"
FT                   /protein_id="ABW25245.1"
FT                   /translation="MTTDIDLNPENLKGLELQPTAEGQPFNWLKQWYPVSPLSYLDDSC
FT                   PTPITLLGKNLVIWQHQGQWIAMDDVCPHKLTQLSLGKVQADGTLVCRQHGWCFDQQGQ
FT                   CVQNPMLPAQLDQPAAYHNVRSHVTTYPTQVEQGLLWIWPDRNDRAFADCQQKQPATLP
FT                   KTSPKWNKTDWHMIEVPLGYTVSIENSFDPVHAQFLHEGIGTFSPANAIPMQGFELLGE
FT                   LSAEEGFVLSHKGYNTFNREMEATRTFRPPCANITQYYLPTGGVQTFQLYFVPTAPEHC
FT                   RYIMKFVMDLEFPARPLSLIQWMNKQMLGLLPEYVQVGLQHLGTYKLNDQDITAMHAQE
FT                   RNEAVIDTGRRRSPFLPSPADQGTLTLKNWLNRFGSGGPEPNSLYAERVESRSNEQLYD
FT                   RWHRHTKLCPSCRRSVEWIAEVQRVCHFMTTMMAILGGIMLLLPLTTRPSLGCFAIAIL
FT                   SLLGHQGLTKLHSHFMSSIPGQGIPSVRLWPTGSARNL"
     atgactacag acattgacct caatccagaa aatctaaagg gtttagagtt acaacctacc        60
     gcagaagggc aacccttcaa ttggctaaag cagtggtatc cggttagccc cttaagctat       120
     cttgatgact cctgtcctac ccccatcacc ttgctcggta aaaatctggt gatctggcaa       180
     catcagggtc agtggattgc aatggatgat gtttgtcccc ataaactgac gcaattatcc       240
     ctaggcaagg ttcaagcgga tggcactctt gtctgccgtc aacatggttg gtgctttgat       300
     cagcagggac agtgtgtcca gaatccgatg ctgcctgctc agttagatca accagccgct       360
     tatcacaatg ttagatctca tgtaactacc tatccgaccc aggttgaaca aggattgctt       420
     tggatttggc cagatcgtaa cgaccgagcc tttgcagact gtcagcaaaa gcagcccgca       480
     acactgccta aaacgagtcc gaagtggaat aagactgatt ggcacatgat agaggttcct       540
     ttaggctaca ctgtttcgat tgaaaacagc tttgaccctg tacatgccca atttctgcat       600
     gaagggatcg gcactttttc acccgcgaac gccattccta tgcagggttt cgaactccta       660
     ggtgagctat ctgcagagga aggttttgtt cttagtcaca aagggtataa caccttcaac       720
     cgagagatgg aggcaactcg aacattccgt cctccttgtg ccaacatcac ccagtactac       780
     ctgccaacgg gtggcgtcca aacctttcaa ctctattttg tcccaacggc accagaacat       840
     tgtcgataca ttatgaagtt cgtgatggac ttagaattcc cagcacgtcc attgagtcta       900
     atacagtgga tgaacaaaca aatgctaggg ttactgcccg agtatgtgca ggttggacta       960
     caacatttgg ggacttacaa actcaatgac caggatatta cagctatgca tgcccaagaa      1020
     cggaatgagg ctgttattga tacgggtcgt agacgttctc ccttccttcc ttctcctgct      1080
     gatcagggaa ctttgacctt aaaaaactgg ctcaatcgat ttgggagtgg tggtcctgaa      1140
     cctaattctc tctacgcaga aagagtggag agccgtagta atgagcaact ctatgaccgc      1200
     tggcatcgcc atactaaact ttgtcctagc tgtcgccgtt ctgtagagtg gattgcagaa      1260
     gttcagcggg tgtgccattt tatgacaact atgatggcaa ttctgggggg aatcatgctt      1320
     ttactgccac tcaccacccg ccccagtttg ggatgttttg caattgcaat tctgagtcta      1380
     ctgggacatc agggactcac aaaattgcac tcgcatttca tgagtagtat tcctgggcaa      1440
     ggaataccaa gcgtacgact ctggcccact ggaagtgctc gaaatctgta g               1491
//

If you have problems or comments...

PBIL Back to PBIL home page