(data stored in ACNUC27125 zone)

EMBL: CP000828.PE156

CP000828.PE156       Location/Qualifiers
FT   CDS_pept        complement(160124..160804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25247"
FT                   /db_xref="GOA:B0C7I7"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7I7"
FT                   /protein_id="ABW25247.1"
FT                   /translation="MAISFAAIHYWARPLHKWLYTSEQIAISFSGGMAITYVFLHLLPE
FT                   LEQGDVSLGRFPIHIVALIGFLLFYGAQRWIWSQTQDDSQELNKRAFWLQMLFISSYNF
FT                   LLIYSIPEQFEQSIPFAFIYVLAMSLHLLSTDHHLSEHYKHLFDQQGRYALIAAVFCGL
FT                   VTDLFAEAANRTFSNTLTALLTGFLMFNIFKEELPDHKETRFVWFLSGVVFYIFLLGGS
FT                   WLLG"
     gtggcgatct cattcgcagc cattcactac tgggctcgcc ccctccataa gtggctttac        60
     acctctgagc aaatcgcgat ttcctttagt ggcggcatgg ctatcaccta tgtgtttttg       120
     cacctcctcc cagaactgga gcagggagat gtttccctag gcagatttcc cattcacatc       180
     gttgctttaa ttggatttct gcttttttac ggcgctcaac gttggatctg gtcgcagaca       240
     caagatgatt cccaggaact gaacaagaga gccttttggc tacagatgtt attcattagc       300
     tcttataact tcttgctcat ctattccatc ccagaacagt tcgagcagag cattcccttt       360
     gcctttatct atgttttggc catgagttta cacctgttat ccaccgatca tcatctgagt       420
     gaacactaca aacatctgtt tgatcaacag ggtcgatatg cattaatcgc agccgtcttt       480
     tgtggactcg tcactgacct atttgcggaa gcagcaaatc gcaccttctc aaataccctc       540
     accgctcttt tgactggatt cttgatgttc aatatcttca aggaagaact tccagaccat       600
     aaagagactc gatttgtctg gtttctaagc ggtgtggtgt tttatatctt tctcttaggt       660
     ggctcttggc tgttgggata a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page