(data stored in ACNUC27125 zone)

EMBL: CP000828.PE157

CP000828.PE157       Location/Qualifiers
FT   CDS_pept        complement(160936..162237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0162"
FT                   /product="NhaP-type Na+/H+ and K+/H+ antiporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25248"
FT                   /db_xref="GOA:B0C7I8"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7I8"
FT                   /protein_id="ABW25248.1"
FT                   /translation="MILEAVTIISLFTLVFGSVSGRIEKSMITPPMIFATFGLLISPLV
FT                   SQLLNLSVDSEVVDIIATTTLVFVLFTDASRIDFKLLKQQYQLPLRLLGIGLPLTILLG
FT                   SGFAIALFPQLNIWEAAAVATILAPTDAALGQAVVNSPNVPVRIRQALNIESGLNDGIC
FT                   LPILLIFLSLAESAGGEQTVASWGGFALAQLIMGSVVGILVGYLGGQLIATTARTHWMT
FT                   ENYQRLSLLSLAALAFCLAEPLGGNGFIAAFCAGLTLGNTNRELCPRLYEYGETEGQFF
FT                   ILVTFVIFGGLMVLPVLTQIQGRVILYAVLSLTAARILSVSLSLVGMKLRWDTQLFLGW
FT                   FGPRGVASILYVLMVLNREAIQGREQIFTIVVSTVLLSIFAHGLSAFPGANWYAQRVRK
FT                   EQSLSKAEHLTVPTMPVRLPYRSSYRPAAARPVE"
     atgatcctag aagccgttac gatcatttcc ctctttaccc tggtatttgg ttcagtttcg        60
     gggcggatcg aaaagagcat gattacgcca ccgatgattt ttgccacctt tggactcttg       120
     attagtccct tggttagcca actgctgaat ctgtccgtgg atagtgaagt ggtagatatt       180
     attgccacca caaccttggt cttcgtcctg ttcaccgatg cgtctcggat tgatttcaaa       240
     ctcttgaaac agcagtatca actgcccctc agactgttgg ggattggctt accgttaacg       300
     atcctgttag gtagcgggtt tgcgatcgca ctctttcccc aactcaatat atgggaagcc       360
     gccgctgttg ctaccatact ggctcccacc gatgccgccc tagggcaggc cgtagtcaat       420
     agtcccaacg tgcccgtgcg aattcgacaa gccttgaata ttgagagtgg gctgaatgac       480
     gggatttgtc tgcctatctt attgattttc ttatccctag ctgagtcagc ggggggagaa       540
     caaactgttg ctagctgggg tgggtttgcc ttggctcaac tcatcatggg atccgtagtg       600
     ggtattctgg tgggctattt gggaggacaa ctgattgcga ccacggctcg tacccattgg       660
     atgactgaga actatcaacg cttatcactg ctttctttgg ctgcactggc cttctgtttg       720
     gctgaacccc tgggtggtaa tggatttatc gctgccttct gtgccggact gaccttaggc       780
     aatacgaatc gagaactttg ccctcgccta tatgaatatg gtgagacaga aggtcagttt       840
     tttatcctcg ttaccttcgt catttttggc ggtctaatgg tcttgcctgt tcttacgcaa       900
     atccagggca gagtgattct ctatgccgtt ctaagcctca ctgcagctag gatcttgagt       960
     gtttccctta gccttgttgg catgaaactc cgttgggaca cccaactatt tctggggtgg      1020
     tttggtcctc gcggcgtggc ctccattctc tacgtgctaa tggttctgaa tcgggaagcc      1080
     atccagggac gagagcagat atttaccatt gtggtgtcta cagttttgct cagcatcttt      1140
     gctcatgggc tgtcagcgtt tcccggtgcc aactggtatg cccaaagagt gaggaaagag      1200
     caatccttgt ctaaggcaga acatttgacg gtacctacaa tgcccgttcg tctaccgtat      1260
     cgctccagtt atcgtccagc cgccgctcgc cctgttgaat ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page